KEGG   Haloterrigena turkmenica: Htur_1051Help
Entry
Htur_1051         CDS       T01154                                 

Definition
alkaline phosphatase D-related protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:htu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:htu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:htu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087132..1089315
Genome map
AA seq 727 aa AA seqDB search
MTDTHADMRAETATDNRRAFLQTIGLAATATGLMGTAAGESDSDESTTDGSDADLVPISH
GVAVGDVTATTAVVWARAAEAATIHVAYSPDQSFDRVGYDRTTVDAETDTTGQLRLEGLE
SNTRYRYHVWATASETAYRPLNGRTDGPKGRGPGGSNGKDDHPGKGRGPEKRPGEDGRGN
DDRIADAIPEAVESGTFVTAPAPDDEAAVSFAWSGDTWGYGDDPVEPPFPGLRTIAERDP
DFFLYHGDTIYADALTPAGKVTEDTPIDEALEIYRGKYKEMRDPPAEVAERTNLQELLQS
TSVYTVWDDHEVINNFAGPIEPLMPEGRRAFREYWPLDRDDDAEPGESNRFYDSFRWGKH
VELFLIDTRQYRDPNVDLDSKTLLGREQLEWLKGALADSDATWKILASPAPLGYPSDSWA
TEADRTGYEAELLEVVEHVQTEPISNLVVVAGDVHKSVVSAYDPDDDGEFEFFEAIAGPL
GAPAGEPDDLYPALNPTEFFAKGEYRNFATADVAESGETLTIGIYDEHGTEQFTKTIRTS
DIDAAADPERPDRIESTFDEDAEGWLVSQNGGSNRPVYHGTGGNPGGHIGDAENEGGVAW
YYQAPFEYLGDREEFYGGRLSFDLRQELTDQQFDAEPVEGGDVLLQSGDRKLVYEFRGAD
DDPGEEWTSYEVSLSADETWIDLTSQEPLTTEERFREVLADLEVLRIRGEYRSGDDTSYL
DNVVLTK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacggacacacacgctgatatgcgggccgaaacggcgacggacaatcgacgggcgttt
ctgcagacgatcggactagcggcgaccgcgaccggactgatgggaaccgcggcgggggaa
tcggattcggacgagtcgacgaccgacggaagcgacgcggacctcgtgccgatctcgcac
ggtgtcgcggtcggcgacgtcaccgccacgacggcggtcgtctgggcgcgagcggccgag
gcggcgacgatccacgtcgcctacagccccgatcagtcgttcgaccgcgtcggatacgat
cggacgaccgtcgacgccgagaccgacacgacgggccagctccgactcgagggactcgag
tcgaacacgcgctaccgctaccacgtctgggccacggcgtcggagaccgcctatcgaccg
ctgaacggtcgaacggacggtccaaagggacgcggtcccggagggtcgaacgggaaggac
gaccatcccggaaagggccgcgggccggagaagcgaccgggcgaggacggtcgcggtaac
gacgatcggatcgccgacgcgatccccgaggcggtcgaaagcgggacgttcgtcacggcg
ccggcgcccgacgacgaagcggccgtctccttcgcctggagcggcgacacgtgggggtac
ggcgacgaccccgtcgaaccgccgttcccggggctgcggacgatcgccgagcgcgacccg
gacttcttcctctaccacggcgacacgatctacgccgacgcgctgacgccggccggcaag
gtaaccgaggacaccccgatcgacgaggccctcgagatctaccgcgggaagtacaaggag
atgcgcgatccgccggccgaggtcgccgagcggaccaacctacaggaactgctgcagtcg
acgtcggtctacaccgtctgggacgaccacgaggtcatcaacaacttcgcggggccgatc
gagccgctgatgcccgaggggcggcgggccttccgcgagtactggccgctggaccgtgac
gacgacgccgagcccggcgaatcgaaccggttctacgactccttccgttgggggaaacac
gtcgaactgttcctcatcgacacgcgccagtaccgcgatccgaacgtcgatctggactcg
aagacgctgctcggacgggagcaactcgagtggctgaagggagcgctcgccgactccgac
gcgacgtggaagatcctcgcctcgccggccccgctcggctacccttccgactcgtgggcg
accgaggcggaccggaccggctacgaggcggaactgctcgaggtcgtcgaacacgtccag
acggagccgatttcgaacctggtcgtcgtcgcgggcgacgtccacaagtcggtcgtgagc
gcgtacgacccggacgacgacggcgagttcgagttcttcgaggccatcgccgggccgctg
ggcgcacccgcgggcgaacccgacgacctctatccggcgctcaaccccacggagttcttc
gcgaagggcgagtaccggaacttcgccaccgccgacgtcgccgagtcgggcgagacgctc
acgatcggaatctacgacgagcacgggaccgagcagttcacgaagacgattcgcacgtcc
gatatcgacgccgcggccgaccccgagcggccggaccgcatcgagagcaccttcgacgag
gacgccgagggctggctcgtctcccagaacggcgggagcaaccggccggtctaccacggg
accggcggcaaccccggcggccacatcggcgacgcggagaacgagggcggcgtcgcctgg
tactatcaggcgccgttcgagtacctcggcgaccgcgaggagttctacggcggtcgactc
tcgttcgaccttcggcaggagctgaccgatcagcagttcgacgccgaacccgtcgagggc
ggcgacgtgctactgcaaagcggcgaccgcaagctcgtctacgagttccgcggcgccgac
gacgaccccggcgaggagtggacctcctacgaggtgtcgctctcggccgacgagacctgg
atcgatctgacgagccaggaacccctcaccaccgaggagcgcttccgcgaggtcctcgcc
gatctcgaggtgctgcgcatccgcggcgagtaccgctccggcgacgacaccagctacctc
gacaacgtcgtcctgacgaagtag

DBGET integrated database retrieval system