KEGG   Haloterrigena turkmenica: Htur_1328Help
Entry
Htur_1328         CDS       T01154                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00010  Glycolysis / Gluconeogenesis
htu00620  Pyruvate metabolism
htu00640  Propanoate metabolism
htu00680  Methane metabolism
htu00720  Carbon fixation pathways in prokaryotes
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01120  Microbial metabolism in diverse environments
htu01130  Biosynthesis of antibiotics
htu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_1328
   00620 Pyruvate metabolism
    Htur_1328
   00640 Propanoate metabolism
    Htur_1328
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_1328
   00680 Methane metabolism
    Htur_1328
Enzymes [BR:htu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Htur_1328
Lipid biosynthesis proteins [BR:htu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Htur_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADB60216
UniProt: D2RPV7
Position
complement(1377893..1379977)
Genome map
AA seq 694 aa AA seqDB search
MSDATDPALEDVDEIVHDPSREFVESTNVYDFMETYGIDDYDELIERTTSEVDGEPESGV
DWFWDELVDYLGIEFYDEYDEIRDDSESEARSASDDASGETASLGGPQFTDWYPGGEINI
AHNVLDRHAAVDEERRNKVATIWEGEDGEIREVTYHELRRQSNKVANALEQRGIETGDTV
GLYMPMVPEVVSILYGCFKVGAIAVPIFSGFGVDAAATRIADSECSVLFTGDGFYRRGDP
VFLKSAADEAIEEAGHVEHTIVFDRLGSSDRHSEREIPWTDDRDEWWVNAVETQRDEYET
KSLDSSQESMLLYSSGTTGKPKGIVHTHAGVQVQCAKEVYFGMDLKPSDRFFWVSDIGWM
MGPWTLIGTHTFGGTVFMYEGAPDHPEPDRFWEMIDRHELTQFGISPTAIRALRKHGDDW
LEGHDLSSLRLLGSTGEPWDPESWRWFYENVGGGEAPIINISGGTEICGCFLMPMPTQPL
KPCTLGGPGLGMDIDIVDRDGNSVREDNQRGFLVARDSCPSMTKSLWSGDERYLNEYWST
FEDPPMWNHGDWAQKDEDGFWFLHGRADDALNVAGRKVGPAEVEGALIDHEAVNQAAAIG
APDETTGTAVVTYVILEDGHEESDDLKEELRAQVGEELGKPFRPREILFVDDLPKTQSGK
IIRRAIEATYTGEDLGDMSSIENPEALEELEAAR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaacagatccggccctcgaggacgtcgacgagatcgtccacgaccccagc
cgggagttcgtcgagtcgacgaacgtctacgatttcatggagacgtacgggatcgacgac
tacgacgagctcatcgagcggacgacgagcgaggtcgacggcgaacccgagagcggcgtc
gactggttctgggacgaactcgtcgactacctcgggatcgagttctacgacgagtacgac
gagatcagagacgacagcgagagcgaggcgcgaagcgcctcggacgatgcgagcggtgaa
accgcgagcctcggtggaccgcagttcaccgactggtaccccggcggcgagatcaatatc
gcccacaacgtgctcgaccgtcacgccgccgtcgacgaggagcgacgcaacaaagtggcg
acgatctgggagggcgaggacggcgagattcgggaggtgacctaccacgaattgcgccgg
cagtcgaacaaggtggccaacgccctcgagcagcggggcatcgagaccggcgacacggtc
ggcctctacatgccgatggtgcccgaggtcgtctccattctgtacggctgtttcaaggtc
ggtgcgatcgcggtccccatcttctcgggcttcggcgtcgacgcggccgcgacccggatc
gcggactcggagtgctcggtgctcttcacgggcgacggcttctatcggcgcggcgatccc
gtcttcctcaagtccgccgcggacgaggcgatcgaggaggccggtcacgtcgagcacacg
atcgtcttcgatcggttgggatccagcgaccgccacagcgaacgcgagatcccctggacc
gacgaccgcgacgagtggtgggtcaacgccgtcgagacgcaacgcgacgagtacgagacg
aagtcgctggactcgagccaggagtcgatgctcctctattcgtcggggacgacgggcaag
cccaaagggatcgtccacacccacgcgggcgtgcaggtccagtgcgccaaggaggtctac
ttcgggatggatctcaagccctcggatcggttcttctgggtttcggacatcggctggatg
atggggccgtggacgctcatcggtacccacactttcggcggcaccgtcttcatgtacgag
ggcgcgcccgaccaccccgaacccgaccgcttctgggagatgatcgaccgccacgagctg
acgcagttcggcatctcaccgacggcgattcgagcgctgcgcaagcacggggacgactgg
ctcgaggggcacgacctctcgtcgctccggctcctcgggtcgacgggcgagccgtgggac
cccgaatcgtggcgctggttctacgagaacgtcggcggcggcgaggcgccgatcatcaac
atctccggcggcaccgagatctgtggctgcttcctgatgccgatgccgacccagccgttg
aagccctgtacgctcggcggtcccggactcggcatggacatcgatatcgtcgatcgggac
gggaattccgtcagggaggacaaccagcggggcttcctcgtcgcgcgggactcctgtccc
tcgatgaccaagtcgctgtggtcgggcgacgagcgctacctgaacgagtactggtcgacc
ttcgaggacccgccgatgtggaaccacggcgactgggcccagaaggacgaagacggcttc
tggttcctccacgggcgggccgacgacgcgctgaacgtggcggggcgcaaagtcggcccc
gctgaagtggagggcgcgctcatcgaccacgaagccgtcaaccaggccgccgccatcggc
gcgccggacgagacgacggggacggcggtcgtcacctacgtcatcctcgaggacggccac
gaggaatcggacgacctcaaggaggaactgcgggcccaggtcggcgaggaactgggcaaa
ccgttccgcccgcgcgagatcctgttcgtcgacgacctcccgaagacccagtcgggcaag
atcattcgccgggccatcgaagccacctacacgggcgaggacttgggcgacatgagcagc
atcgagaaccccgaggcgctcgaggaactcgaggcggccagatag

DBGET integrated database retrieval system