KEGG   Haloterrigena turkmenica: Htur_1328Help
Entry
Htur_1328         CDS       T01154                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_1328
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_1328
   00620 Pyruvate metabolism
    Htur_1328
   00640 Propanoate metabolism
    Htur_1328
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_1328
   00680 Methane metabolism
    Htur_1328
Enzymes [BR:htu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Htur_1328
Lipid biosynthesis proteins [BR:htu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Htur_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377893..1379977)
Genome map
AA seq 694 aa AA seqDB search
MSDATDPALEDVDEIVHDPSREFVESTNVYDFMETYGIDDYDELIERTTSEVDGEPESGV
DWFWDELVDYLGIEFYDEYDEIRDDSESEARSASDDASGETASLGGPQFTDWYPGGEINI
AHNVLDRHAAVDEERRNKVATIWEGEDGEIREVTYHELRRQSNKVANALEQRGIETGDTV
GLYMPMVPEVVSILYGCFKVGAIAVPIFSGFGVDAAATRIADSECSVLFTGDGFYRRGDP
VFLKSAADEAIEEAGHVEHTIVFDRLGSSDRHSEREIPWTDDRDEWWVNAVETQRDEYET
KSLDSSQESMLLYSSGTTGKPKGIVHTHAGVQVQCAKEVYFGMDLKPSDRFFWVSDIGWM
MGPWTLIGTHTFGGTVFMYEGAPDHPEPDRFWEMIDRHELTQFGISPTAIRALRKHGDDW
LEGHDLSSLRLLGSTGEPWDPESWRWFYENVGGGEAPIINISGGTEICGCFLMPMPTQPL
KPCTLGGPGLGMDIDIVDRDGNSVREDNQRGFLVARDSCPSMTKSLWSGDERYLNEYWST
FEDPPMWNHGDWAQKDEDGFWFLHGRADDALNVAGRKVGPAEVEGALIDHEAVNQAAAIG
APDETTGTAVVTYVILEDGHEESDDLKEELRAQVGEELGKPFRPREILFVDDLPKTQSGK
IIRRAIEATYTGEDLGDMSSIENPEALEELEAAR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaacagatccggccctcgaggacgtcgacgagatcgtccacgaccccagc
cgggagttcgtcgagtcgacgaacgtctacgatttcatggagacgtacgggatcgacgac
tacgacgagctcatcgagcggacgacgagcgaggtcgacggcgaacccgagagcggcgtc
gactggttctgggacgaactcgtcgactacctcgggatcgagttctacgacgagtacgac
gagatcagagacgacagcgagagcgaggcgcgaagcgcctcggacgatgcgagcggtgaa
accgcgagcctcggtggaccgcagttcaccgactggtaccccggcggcgagatcaatatc
gcccacaacgtgctcgaccgtcacgccgccgtcgacgaggagcgacgcaacaaagtggcg
acgatctgggagggcgaggacggcgagattcgggaggtgacctaccacgaattgcgccgg
cagtcgaacaaggtggccaacgccctcgagcagcggggcatcgagaccggcgacacggtc
ggcctctacatgccgatggtgcccgaggtcgtctccattctgtacggctgtttcaaggtc
ggtgcgatcgcggtccccatcttctcgggcttcggcgtcgacgcggccgcgacccggatc
gcggactcggagtgctcggtgctcttcacgggcgacggcttctatcggcgcggcgatccc
gtcttcctcaagtccgccgcggacgaggcgatcgaggaggccggtcacgtcgagcacacg
atcgtcttcgatcggttgggatccagcgaccgccacagcgaacgcgagatcccctggacc
gacgaccgcgacgagtggtgggtcaacgccgtcgagacgcaacgcgacgagtacgagacg
aagtcgctggactcgagccaggagtcgatgctcctctattcgtcggggacgacgggcaag
cccaaagggatcgtccacacccacgcgggcgtgcaggtccagtgcgccaaggaggtctac
ttcgggatggatctcaagccctcggatcggttcttctgggtttcggacatcggctggatg
atggggccgtggacgctcatcggtacccacactttcggcggcaccgtcttcatgtacgag
ggcgcgcccgaccaccccgaacccgaccgcttctgggagatgatcgaccgccacgagctg
acgcagttcggcatctcaccgacggcgattcgagcgctgcgcaagcacggggacgactgg
ctcgaggggcacgacctctcgtcgctccggctcctcgggtcgacgggcgagccgtgggac
cccgaatcgtggcgctggttctacgagaacgtcggcggcggcgaggcgccgatcatcaac
atctccggcggcaccgagatctgtggctgcttcctgatgccgatgccgacccagccgttg
aagccctgtacgctcggcggtcccggactcggcatggacatcgatatcgtcgatcgggac
gggaattccgtcagggaggacaaccagcggggcttcctcgtcgcgcgggactcctgtccc
tcgatgaccaagtcgctgtggtcgggcgacgagcgctacctgaacgagtactggtcgacc
ttcgaggacccgccgatgtggaaccacggcgactgggcccagaaggacgaagacggcttc
tggttcctccacgggcgggccgacgacgcgctgaacgtggcggggcgcaaagtcggcccc
gctgaagtggagggcgcgctcatcgaccacgaagccgtcaaccaggccgccgccatcggc
gcgccggacgagacgacggggacggcggtcgtcacctacgtcatcctcgaggacggccac
gaggaatcggacgacctcaaggaggaactgcgggcccaggtcggcgaggaactgggcaaa
ccgttccgcccgcgcgagatcctgttcgtcgacgacctcccgaagacccagtcgggcaag
atcattcgccgggccatcgaagccacctacacgggcgaggacttgggcgacatgagcagc
atcgagaaccccgaggcgctcgaggaactcgaggcggccagatag

DBGET integrated database retrieval system