KEGG   Haloterrigena turkmenica: Htur_1329Help
Entry
Htur_1329         CDS       T01154                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00072  Synthesis and degradation of ketone bodies
htu00650  Butanoate metabolism
htu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Htur_1329
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Htur_1329
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Htur_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR Polysacc_synt_2 Methyltransf_25 GDP_Man_Dehyd VCBS
Motif
Other DBs
NCBI-ProteinID: ADB60217
UniProt: D2RPV8
Position
complement(1379980..1380837)
Genome map
AA seq 285 aa AA seqDB search
MSQDQVTPPTVTAEEIHRIDDDAFTDRNVCLVTGAGSGIGRATALAAAGNGLTVAATDID
EDGLAGTVDRGEELGLEGDIETVVGDLTEDDDLERIVDEAAELGDIKYLANVAGMQHIDS
IENFPMETYDTMHRIMLRAPLYLSKLCIPHFRETEDGRGCVGNMGSVHGHYVTSDKVGYN
VSKFGLRGLTQSIAAEGEGEIRAYSISTGYVKTPLVTDQLEDTAEQRGISVDEVIEDVML
GQSRVKEMMEPIDVANLFLLGFSDLGRHLDGGDLLFDGGMTLTYE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaccaggtgacgccaccgaccgtgaccgccgaggagattcaccggatcgac
gacgacgcctttaccgaccgcaacgtctgtctcgtgaccggcgccgggtcggggatcggt
cgcgcgaccgcgctcgccgccgccgggaacggcctcaccgtcgcggcgacggacatcgac
gaggacggcctcgccgggaccgtcgaccggggcgaagaactcggcctcgagggcgacatc
gagacggtcgtcggcgatctgaccgaggacgacgacttagagcggatcgtcgacgaggcg
gccgaactgggcgatatcaagtacctcgctaacgtcgccgggatgcaacacatcgactcg
atcgagaacttcccgatggagacctacgatacgatgcaccgaatcatgctccgggcgccg
ctgtacctctcgaagctctgcattccgcacttccgggagaccgaggacgggcggggctgc
gtcggcaacatgggttcggtccacggccactacgtcaccagcgacaaggtcggttacaac
gtctcgaagttcggcctgcgcggcctgacacagtcgatcgccgccgagggcgagggggag
attcgcgcctactcgatcagcaccggctacgtgaagacgccgctggtgaccgatcaactc
gaggataccgccgaacagcgcgggatctcggtcgacgaggtgatcgaggacgtcatgctc
ggccagtcccgcgtcaaggagatgatggaaccgatcgacgtcgccaacctcttcctgctc
ggcttctcggatctcggccgacacctcgacggcggcgacctgttgtttgatggtggcatg
acccttacctacgagtaa

DBGET integrated database retrieval system