KEGG   Haloterrigena turkmenica: Htur_1681Help
Entry
Htur_1681         CDS       T01154                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
htu  Haloterrigena turkmenica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:htu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:htu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1746572..1747117)
Genome map
AA seq 181 aa AA seqDB search
MTAIDDSAPVETDRELVGIVAVADNGVIGKDGDMPWHIPADLKHFKETTMDHPIIMGRVT
YEGILEALGEPLPGRTTVVLTSRDLETPENAVTARSLEEALEAAETAARERHDAADRIFV
AGGATVYEQFLSALDRLIVTEVHEEPDGDTYFPDWDRASFDDVSRDDRDGFAFVEYVRRS
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatcgacgactccgctcccgtcgagaccgaccgcgaactcgtgggtatcgtc
gccgtcgccgacaacggcgtcatcgggaaggacggcgacatgccgtggcacattcccgcg
gacctgaagcacttcaaggagaccacgatggatcatcccatcatcatgggccgggtcacc
tacgaggggatcctcgaggcgctgggcgaaccgctgcccggccgaacgacggtggttctg
acgagtcgggacctcgagactcccgagaacgccgtcacagcgaggagtctcgaggaggca
ctcgaggcggcggagacggctgcgcgcgaacgacacgacgccgcggatcggatcttcgtc
gccggcggcgcgacggtctacgagcagttcctgtccgcgctcgaccggctgatcgtgacc
gaagtccacgaggaacccgacggggacacgtacttccccgactgggaccgagcgtcgttc
gacgacgtttctcgagacgaccgcgacggtttcgcgttcgtcgagtacgtccggcgttcg
tcctga

DBGET integrated database retrieval system