KEGG   Haloterrigena turkmenica: Htur_1844Help
Entry
Htur_1844         CDS       T01154                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
htu  Haloterrigena turkmenica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:htu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920044..1921237
Genome map
AA seq 397 aa AA seqDB search
MHNVDAAGLGIGDDYPPRIMGVLNVSEESPYDPSVYDDPGEAARYVDEELIGDGADIVDI
GLESANKRFDVLSADEELERLHIALETIESVSGDAVFSIETRYAEVADAALSKGFDMVND
IAGFADPEMPVVCEEYDAAVAKMASPPNLERPGAVEETDWAARKSVDWAERADYVDQVYE
ALKQNGLTDKTIVDPAFGGWSEAQTLENDRETFRRLREFRALDRPMLVSINRKNFLGEVA
GRETDERLPVSLAATSMAVERGAHVIRTHDVAETRDAALIGDAFTERSRTVDDDLSVTRL
DVHSSRELRTYLDERGVDPTVADDWYALAIEVEGLRSEDRDRIRSIVDDADASVYRGTNN
QILIVGSVTGISAVKTRLRDERGDLSSVGESLAQMLE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacgtcgacgctgcggggctggggatcggtgacgactacccgccccgcattatg
ggcgtgttgaacgtcagcgaggagtccccctacgacccgagcgtctatgacgaccccggc
gaggcggcccgatacgtcgacgaggaactcatcggtgacggcgccgacatcgtcgatatc
ggcctcgagtcggcgaacaaacggttcgacgtgctctccgccgacgaggaactcgagcgc
ctccatatcgctctggagacgatcgagagcgtctccggggacgccgtcttctcgatcgag
acccgctacgccgaggtggccgacgcggccctctcgaaggggttcgacatggtcaacgac
atcgccggcttcgcggacccggagatgccggtcgtctgcgaggagtacgacgccgccgtc
gcgaagatggccagtccgccgaacctcgagcggccgggggccgtagaggaaaccgactgg
gccgcgcgcaagtcggtggactgggccgagcgggccgactacgtcgatcaggtctacgag
gccctcaagcagaacggcctgaccgacaagacgatcgtcgaccccgccttcggcggctgg
agcgaggcccagaccctcgagaacgaccgcgagaccttccgtcgactgcgcgagttccgc
gcgctcgaccggccgatgctagtctcgatcaaccggaagaacttcctcggtgaggtcgcc
ggtcgcgagaccgacgagcggctcccggtcagcctcgcggccacgtcgatggccgtcgag
cgcggcgcgcacgtgatccggacccacgacgtcgccgagacgcgggacgcggccctgatc
ggcgacgcgttcaccgagcgctcgcggaccgtcgacgacgacctctcggtgacccgactc
gacgtccactcgagtcgggaactgcgaacgtacctcgacgaacgcggcgtcgatcccacc
gtcgccgacgactggtacgcgctcgcgatcgaggtcgagggactccggagcgaggatcgg
gaccgtattcggtcgatcgtcgacgacgccgacgcgtccgtgtatcgtggtaccaataat
cagatattgattgtcggctcggtaaccggaatttccgccgtcaaaacgcgtctccgcgac
gaacggggagatctgtcttcggtcggggagtcgctcgcgcaaatgcttgagtaa

DBGET integrated database retrieval system