KEGG   Haloterrigena turkmenica: Htur_1904Help
Entry
Htur_1904         CDS       T01154                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:htu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:htu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:htu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:htu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:htu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979089..1979733
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVAVADAVRDVDESTDARLAVAPQAADLARVAETGVETWAQHVDPIE
HGSNTGHTLAESVADAGAVGTLINHSERRLKLADIDGSVRAAERAGLETVVCANNPEQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVEAADNVDSEVSVLCGAGISTGDDV
VAAGDLGAEGVLLASGVAKADDPQAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacgtatccctgtgatcccgtcgcggtcgccgacgcc
gtccgcgacgtcgacgaatcgaccgacgcgcgcctcgcggtcgcgccccaggcggccgac
ctcgcacgcgtcgccgagacgggcgtcgagacgtgggcccagcacgtcgacccgatcgag
cacggcagcaacaccggccacacgctcgccgagtcggtcgccgacgcgggcgcggtcggg
acgctgatcaaccactccgagcggcggctgaaactggccgacatcgacggctccgtccgc
gccgccgagcgcgcgggcctcgagacggtcgtctgcgcgaacaaccccgagcagatcggc
gccgcggcggcgctgggtccggacgcggtcgccgtcgagccgccggaactgatcggcacc
ggaacgccggtcagccaggccgatcccgatatcgtcgaggacgccgtcgaggcggccgac
aacgtcgatagcgaggtctcggtcctctgtggcgccggcatcagcaccggcgacgacgtc
gtcgcggccggcgacctcggcgccgaaggcgtcctgctggccagcggcgtcgcgaaggcc
gacgatccgcaggcggcgctggaggacctcgtcgacccgctctga

DBGET integrated database retrieval system