KEGG   Haloterrigena turkmenica: Htur_1904Help
Entry
Htur_1904         CDS       T01154                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00010  Glycolysis / Gluconeogenesis
htu00051  Fructose and mannose metabolism
htu00562  Inositol phosphate metabolism
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01120  Microbial metabolism in diverse environments
htu01130  Biosynthesis of antibiotics
htu01200  Carbon metabolism
htu01230  Biosynthesis of amino acids
Module
htu_M00002  Glycolysis, core module involving three-carbon compounds
htu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_1904
   00051 Fructose and mannose metabolism
    Htur_1904
   00562 Inositol phosphate metabolism
    Htur_1904
Enzymes [BR:htu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Htur_1904
Exosome [BR:htu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Htur_1904
  Exosomal proteins of bladder cancer cells
   Htur_1904
  Exosomal proteins of melanoma cells
   Htur_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS Glu_synthase NMO Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADB60789
UniProt: D2RSL3
Position
1979089..1979733
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVAVADAVRDVDESTDARLAVAPQAADLARVAETGVETWAQHVDPIE
HGSNTGHTLAESVADAGAVGTLINHSERRLKLADIDGSVRAAERAGLETVVCANNPEQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVEAADNVDSEVSVLCGAGISTGDDV
VAAGDLGAEGVLLASGVAKADDPQAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacgtatccctgtgatcccgtcgcggtcgccgacgcc
gtccgcgacgtcgacgaatcgaccgacgcgcgcctcgcggtcgcgccccaggcggccgac
ctcgcacgcgtcgccgagacgggcgtcgagacgtgggcccagcacgtcgacccgatcgag
cacggcagcaacaccggccacacgctcgccgagtcggtcgccgacgcgggcgcggtcggg
acgctgatcaaccactccgagcggcggctgaaactggccgacatcgacggctccgtccgc
gccgccgagcgcgcgggcctcgagacggtcgtctgcgcgaacaaccccgagcagatcggc
gccgcggcggcgctgggtccggacgcggtcgccgtcgagccgccggaactgatcggcacc
ggaacgccggtcagccaggccgatcccgatatcgtcgaggacgccgtcgaggcggccgac
aacgtcgatagcgaggtctcggtcctctgtggcgccggcatcagcaccggcgacgacgtc
gtcgcggccggcgacctcggcgccgaaggcgtcctgctggccagcggcgtcgcgaaggcc
gacgatccgcaggcggcgctggaggacctcgtcgacccgctctga

DBGET integrated database retrieval system