KEGG   Haloterrigena turkmenica: Htur_1904Help
Entry
Htur_1904         CDS       T01154                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_1904
   01230 Biosynthesis of amino acids
    Htur_1904
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_1904
   00051 Fructose and mannose metabolism
    Htur_1904
   00562 Inositol phosphate metabolism
    Htur_1904
Enzymes [BR:htu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Htur_1904
Exosome [BR:htu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Htur_1904
  Exosomal proteins of bladder cancer cells
   Htur_1904
  Exosomal proteins of melanoma cells
   Htur_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979089..1979733
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVAVADAVRDVDESTDARLAVAPQAADLARVAETGVETWAQHVDPIE
HGSNTGHTLAESVADAGAVGTLINHSERRLKLADIDGSVRAAERAGLETVVCANNPEQIG
AAAALGPDAVAVEPPELIGTGTPVSQADPDIVEDAVEAADNVDSEVSVLCGAGISTGDDV
VAAGDLGAEGVLLASGVAKADDPQAALEDLVDPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgttaacctgaagacgtatccctgtgatcccgtcgcggtcgccgacgcc
gtccgcgacgtcgacgaatcgaccgacgcgcgcctcgcggtcgcgccccaggcggccgac
ctcgcacgcgtcgccgagacgggcgtcgagacgtgggcccagcacgtcgacccgatcgag
cacggcagcaacaccggccacacgctcgccgagtcggtcgccgacgcgggcgcggtcggg
acgctgatcaaccactccgagcggcggctgaaactggccgacatcgacggctccgtccgc
gccgccgagcgcgcgggcctcgagacggtcgtctgcgcgaacaaccccgagcagatcggc
gccgcggcggcgctgggtccggacgcggtcgccgtcgagccgccggaactgatcggcacc
ggaacgccggtcagccaggccgatcccgatatcgtcgaggacgccgtcgaggcggccgac
aacgtcgatagcgaggtctcggtcctctgtggcgccggcatcagcaccggcgacgacgtc
gtcgcggccggcgacctcggcgccgaaggcgtcctgctggccagcggcgtcgcgaaggcc
gacgatccgcaggcggcgctggaggacctcgtcgacccgctctga

DBGET integrated database retrieval system