KEGG   Haloterrigena turkmenica: Htur_1946Help
Entry
Htur_1946         CDS       T01154                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:htu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:htu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:htu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:htu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:htu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017713..2019389
Genome map
AA seq 558 aa AA seqDB search
MAYTVTLEGETYDAASESFAWDVPDEFNAAADLVGKHDDGERVALYQVDDDGGHEEYTFD
DLDERSNAVATALASRGLEREDRVAVVVPQKPANVLTHLAAWKLGAISLPLSVLFGDDAL
RYRLTDSEARVAVVDASQWETMREVAPDCPALEYVFVVDDGESVDGDADEAALEDVTVER
FDEAIDWDETAFDRADTDVDTPAIVMYTSGSTGEPKGVLHTHGVWLGHCPAFQMYFERDV
RDGVYWTPADWAWIGALGDLVFPAWHYGQPVVGYPMGSFDPEQAYELMAEFDVTNAFVPP
TAIRMLMNVADPTDRYDLSLEAICSGGEPLTREILEWADEELAGVVVNELYGQTEANLLV
TNCREWFPAKPGSMGQPVPGHDVAVLDPETGERVESGEIGEIAVRRGDDPVIFEEYWNAP
EKTEAVTLKDGPDGTVWHLTGDLAKRDEDGYCWFTSRDDDLIITSGYRVAPREVEETILA
HDAVEQVGVVGVPDETRGEIIKAVVQPVSGETGSDELRSEIRNRVREKLAEYEYPREIEF
VDELPTTTTGKIRRTELV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacaccgtcacgctcgagggcgagacgtacgacgcggcgtccgaatcgttcgcg
tgggacgtgccggacgagttcaacgcggccgcggatctggtcgggaaacacgacgacggc
gagcgggtcgcgctgtatcaggtcgacgacgacgggggtcacgaggagtacacgttcgac
gatctcgacgagcggtcgaacgccgtcgcgaccgcgctcgcgtctcgcggtctcgagcgc
gaggaccgagtcgcggtcgtcgtcccgcaaaagcccgcgaacgtcctgacgcatctggcc
gcctggaaactgggcgcgatctcgctgccgctatcggtgctgttcggcgacgacgcgctc
cgctatcggctgaccgacagcgaggcccgcgtcgccgtcgtcgacgcgagccaatgggag
acgatgcgtgaggtcgcgcccgactgtcccgccctcgagtacgtgttcgtcgtcgacgac
ggagaatcagtcgacggagacgcggacgaggcggcgctcgaggacgtaaccgtcgaacga
ttcgacgaagccatcgactgggacgagacggcgttcgaccgcgccgacaccgacgtcgac
acgcccgcgatcgtcatgtacaccagcggaagcaccggcgaaccgaagggcgtgctccac
acccacggcgtctggctcggccactgtcccgcgttccagatgtacttcgagcgcgacgtc
cgcgacggcgtctactggacgcccgccgactgggcctggatcggcgcactcggcgacctc
gtcttccccgcctggcactacgggcagccggtcgtcggctacccgatgggctcgttcgat
cccgagcaggcctacgaactcatggccgagttcgacgtgacgaacgcgttcgtcccgccg
accgcgatccggatgctcatgaacgtagcggacccgaccgaccggtacgacctctcgctc
gaggcgatctgttcgggcggcgaacccctgactcgggagatcctcgagtgggccgacgag
gaactcgccggcgtggtcgtcaacgaactctacggccagacggaggcgaacctgctcgtg
acgaactgccgggagtggttccccgcgaagccgggcagcatggggcagccggtgccgggc
cacgacgtcgccgtcctcgatccggagacgggcgagcgggtcgaatcgggtgagatcggc
gagatcgcggtccgccgcggcgacgatcccgtgattttcgaggagtactggaacgccccg
gagaagacggaggcggtgacgcttaaggacgggccggacgggaccgtctggcacctgacc
ggcgatctggccaaacgtgatgaggacggctactgctggttcacctcgcgggacgacgac
ctcatcatcacgagcggttaccgggtcgcgccgcgggaggtcgaggaaacgatcctcgca
cacgacgccgtcgaacaggtcggcgtcgtcggcgtccccgacgagacccgcggggagatc
atcaaggcggtcgtccagccggtctcgggggagacggggtcggacgaactgcgaagcgag
attcgcaatcgcgtccgcgagaagctagccgagtacgagtatccgcgcgaaatcgagttc
gtcgacgaactgccgaccacgacgaccggcaaaatccggcgaacggaactggtctga

DBGET integrated database retrieval system