KEGG   Haloterrigena turkmenica: Htur_2062Help
Entry
Htur_2062         CDS       T01154                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
htu  Haloterrigena turkmenica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_2062
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Htur_2062
   00640 Propanoate metabolism
    Htur_2062
   00660 C5-Branched dibasic acid metabolism
    Htur_2062
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_2062
Enzymes [BR:htu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Htur_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2129793..2130947)
Genome map
AA seq 384 aa AA seqDB search
MAMKLHEYQAKQVFADAGIPTPASELASDVDGAVAAAEEIGYPVAIKAQVQVGGRGKAGG
IKLVEDEDEAREAADEILGMDLKGYHVDRVLVEEAVDFTNELYVGITMDRGEGKPVAMVS
TKGGVNIEEVAEEDPDAIAREHIDPAFGMHPYQARKAVYDAGVDQSIARDVSSVLTTLYQ
LWDDRDGSDAEINPLMVTSDDEVIAADAVMNIDEDALFRQPELAEMEEEAAGGDELEQKA
DEYDFDYVRLDGNVGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAERIANALDMV
FSDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNED
LVTVEQTLEDAVQRAVEYAGEVNE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaaattgcacgagtaccaggcgaagcaggtcttcgccgacgccggcatcccg
acgccggcatcagaactcgcctccgacgtcgacggcgcggtcgccgcggccgaggagatc
gggtatccagtcgcgatcaaggcgcaggtacaagtcggcggccgcggcaaggccggcgga
atcaaactcgtcgaggacgaggacgaagcgcgcgaggcggccgacgagattctggggatg
gatctcaagggctaccacgtcgatcgcgtcctcgtcgaggaagcggtcgatttcactaac
gaactctacgtggggatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcg
acgaaaggcggcgtcaacatcgaggaggtcgccgaggaggaccccgacgccatcgcgcgc
gagcacatcgatcccgcattcggaatgcacccgtatcaggcccgcaaggcggtctacgac
gcgggcgtcgatcaatcaatcgcacgtgacgtctcgagcgtcctcactacgctctaccag
ctctgggacgaccgcgacggctccgacgccgagatcaacccgctgatggtcaccagcgac
gacgaggtcatcgcggccgacgccgtgatgaacatcgacgaggacgcgctgttccgccag
cccgaactcgccgagatggaagaggaggctgcaggtggcgacgaactcgagcagaaggcc
gacgagtacgacttcgactacgtccgtctggacgggaacgtcggcatcatcggcaacggc
gccggtctcgtcatgacgacgctggacctcgtcgatcactacggcggcgagcccgctaac
ttcctcgacgtcggtggcggcgcgaaggccgagcgcatcgcgaacgcgctcgacatggtg
ttctcggacgacaacgtcgattcggtcgtcttcaacatcttcggcgggatcacgcgcggc
gacgaggtcgcccgcgggatcaacgaagcgctcgagcagttcgacgagatccccaagccg
gtcgtcgttcgactggccggcaccaactgggaggaaggcatggaaattctcaacgaagac
ctcgtgacggtcgaacagaccctcgaggatgcggtacagcgtgcagtcgagtacgctggg
gaggtgaacgaataa

DBGET integrated database retrieval system