KEGG   Haloterrigena turkmenica: Htur_2266Help
Entry
Htur_2266         CDS       T01154                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:htu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:htu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2331445..2332365)
Genome map
AA seq 306 aa AA seqDB search
MTTTVRIIGAPMDYGADRRGVDMGPSAIRYAEVADRLSDAGVTAVDDGDLLIPRAEERDP
NTDGPIEGTAKFLREVEDVSTRLEERVANALADGEFPLVLGGDHSVAIGSMRGSAREADL
GAIWFDAHADLNTPETSPSGNVHGMPLAATLGRGAFGDLSWARAPRVREGSIAYVGLRSI
DEHERELVRDSEMTAYTMADIDERGMTAVVEDALDVATDGTDGVHVSLDLDWVDPKTAPG
VGTPVRGGVTYREAHAALETVSERHAAEGILRSMDVVEVNPILDEGNETATIAAELTASA
FGNRIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactacgaccgtcagaatcatcggcgcgccgatggactacggggcggatcgtcgcggc
gtggacatgggaccgtcggcgatcagatacgccgaggtggccgatcggctctcggacgcc
ggcgtcaccgccgtcgacgacggcgacctcctgattccgcgggccgaagagcgcgatccg
aacaccgacgggccgatcgaggggacggcgaagttcctccgcgaggtcgaggacgtcagt
acgcgactcgaagagcgcgtcgcgaacgccctggcagacggcgagtttccgctcgtccta
ggcggggaccactcggtcgcgatcggctcgatgcgcggttcggcccgcgaagcggacctc
ggcgcgatttggttcgacgcccacgcggacctcaacacgcccgagacctcgcccagcggc
aacgtccacgggatgccgctggccgcgacgctggggcggggcgccttcggcgacctgtcg
tgggcccgcgcgccgcgcgtccgcgaggggtcgatcgcctacgtcggactccggagcatc
gacgagcacgagcgcgaactggtccgcgacagcgagatgacggcgtacacgatggccgac
atcgacgagcgcgggatgaccgccgtcgtcgaggacgccctcgatgtcgcgaccgacggc
accgacggcgtccacgtcagtctcgacctagactgggtcgatcccaagaccgcgccgggg
gtcggcacgcccgtccgggggggcgtcacctaccgggaggcccacgccgcactcgagacg
gtttccgaacgtcacgcggccgaggggatcctccgatcgatggacgtcgtcgaggtcaac
ccgatcctggacgagggcaacgagacggcgaccatcgcggccgaactcaccgcgagcgcg
ttcgggaaccggatcctctga

DBGET integrated database retrieval system