KEGG   Haloterrigena turkmenica: Htur_2266Help
Entry
Htur_2266         CDS       T01154                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00220  Arginine biosynthesis
htu00330  Arginine and proline metabolism
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01130  Biosynthesis of antibiotics
htu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Htur_2266
   00330 Arginine and proline metabolism
    Htur_2266
Enzymes [BR:htu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Htur_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADB61146
UniProt: D2RUH4
Position
complement(2331445..2332365)
Genome map
AA seq 306 aa AA seqDB search
MTTTVRIIGAPMDYGADRRGVDMGPSAIRYAEVADRLSDAGVTAVDDGDLLIPRAEERDP
NTDGPIEGTAKFLREVEDVSTRLEERVANALADGEFPLVLGGDHSVAIGSMRGSAREADL
GAIWFDAHADLNTPETSPSGNVHGMPLAATLGRGAFGDLSWARAPRVREGSIAYVGLRSI
DEHERELVRDSEMTAYTMADIDERGMTAVVEDALDVATDGTDGVHVSLDLDWVDPKTAPG
VGTPVRGGVTYREAHAALETVSERHAAEGILRSMDVVEVNPILDEGNETATIAAELTASA
FGNRIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactacgaccgtcagaatcatcggcgcgccgatggactacggggcggatcgtcgcggc
gtggacatgggaccgtcggcgatcagatacgccgaggtggccgatcggctctcggacgcc
ggcgtcaccgccgtcgacgacggcgacctcctgattccgcgggccgaagagcgcgatccg
aacaccgacgggccgatcgaggggacggcgaagttcctccgcgaggtcgaggacgtcagt
acgcgactcgaagagcgcgtcgcgaacgccctggcagacggcgagtttccgctcgtccta
ggcggggaccactcggtcgcgatcggctcgatgcgcggttcggcccgcgaagcggacctc
ggcgcgatttggttcgacgcccacgcggacctcaacacgcccgagacctcgcccagcggc
aacgtccacgggatgccgctggccgcgacgctggggcggggcgccttcggcgacctgtcg
tgggcccgcgcgccgcgcgtccgcgaggggtcgatcgcctacgtcggactccggagcatc
gacgagcacgagcgcgaactggtccgcgacagcgagatgacggcgtacacgatggccgac
atcgacgagcgcgggatgaccgccgtcgtcgaggacgccctcgatgtcgcgaccgacggc
accgacggcgtccacgtcagtctcgacctagactgggtcgatcccaagaccgcgccgggg
gtcggcacgcccgtccgggggggcgtcacctaccgggaggcccacgccgcactcgagacg
gtttccgaacgtcacgcggccgaggggatcctccgatcgatggacgtcgtcgaggtcaac
ccgatcctggacgagggcaacgagacggcgaccatcgcggccgaactcaccgcgagcgcg
ttcgggaaccggatcctctga

DBGET integrated database retrieval system