KEGG   Haloterrigena turkmenica: Htur_2706Help
Entry
Htur_2706         CDS       T01154                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Htur_2706
Transfer RNA biogenesis [BR:htu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Htur_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2780970..2782631
Genome map
AA seq 553 aa AA seqDB search
MSTETPEPTETEAFERVCETLVERIVNGEIERDEVEKAKLEACSEHSAPKVPKNSELLDY
APQEYREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
EEPAAARGVQNDYDPYGQVTLRLEQLREIGHPIDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVEKEPEPAEGESFAQDPEEYDWKYVEDVITENETADVRNIGTTFETKPDWCD
PEQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGVQESMEANQRLRDSAFKVGFHMMPG
QPGMSKEMCLEDFRRIFEAEAWKPDYLKIYPTLIVRGTATYDWWHNGEFDPLDNDEAAEL
VAEIKDMIPRYTRLQRVQRDIPADYIDAGVWKSNLRQLARKRMDDHDWTCECIRCREAGM
NDETPENVELDVMTYDACGGTEHFISFEDFEQDLLVGFCRLRFPNDPVRPELENAALVRE
LHVYGSEVTVGDEGATDQHQHRGYGRRLMARAEELAADAGYDKVSVISGIGAREYYREKL
GYHQDGPYVSKRL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgaaccgaccgaaaccgaagcgttcgagcgggtctgcgagacg
ctcgtcgagcggatcgtcaacggcgagatcgagcgcgacgaggtcgagaaagccaaactc
gaggcctgttcggaacactcggcgccgaaggtgccgaagaactccgaactgctcgattac
gcgccccaggagtaccgcgaggatctcgaggcggtcctccagcgtaagcccgtccgtacc
gcctcgggcgtctcgccggtcgcgatcatgacctcgcccgagcggtgtccccacgggaag
tgtctctactgccccggcggtcccgactcggagttctcctcctcccagagttacacgggc
gaggagcccgcggccgcccgcggggtccagaacgattacgacccctacgggcaggtgacg
ctccgactcgagcagctacgcgagatcggccaccccatcgacaaggtcgaactgatcctg
atgggcggcacgatgaccgcccggagccacgactaccaagagtggttcgtcaagcgggcc
ctcgaggcgatgaacgactacgatgtcgagaaggagcccgaaccggccgagggcgagagc
ttcgcgcaggaccccgaggagtacgactggaagtacgtcgaggacgtcatcacggaaaac
gagaccgcggacgtccgcaacatcggcaccacgtttgagaccaaacccgactggtgcgat
cccgaacagatcgatcgcatgctcgatctcggcgggaccaaagtcgaggtcggcgtccag
acgacctacgagcgcataaatcgggaaatgcaccgcggccacggcgtccaggagtcgatg
gaggccaaccagcggctgcgggattcggcgttcaaggtcggcttccacatgatgcccggc
cagcccggaatgtccaaggagatgtgtctcgaggacttccgccggatcttcgaggcggag
gcctggaagcccgactacctgaagatctacccgacgctgatcgtccgcgggacggcgacc
tacgactggtggcacaacggcgagttcgatccgctcgacaacgacgaggccgccgaactg
gtcgccgagatcaaagacatgataccccgctacacgcgcctgcagcgcgtccagcgggac
atcccggcggactacatcgacgccggcgtctggaagtcgaacctccgacagctcgcccgc
aagcggatggacgaccacgactggacctgtgagtgtatccgctgtcgcgaggccgggatg
aatgacgagacgcccgagaacgtcgaactcgacgtgatgacctacgacgcctgcggcggg
acggaacacttcatctccttcgaggacttcgagcaggacctgctggtcggcttctgccgc
ctgcggttcccgaacgatcccgtccgaccggaactcgagaacgccgcgctcgtccgcgaa
ctccacgtctacggcagcgaagtcacagtcggcgacgagggagcaacggaccagcatcaa
caccgcggctacggccgccgactcatggcccgcgccgaggaactcgccgccgacgccggc
tacgacaaggtcagcgtcatctcgggcatcggcgcccgcgagtactaccgggagaaactc
ggctatcatcaggacgggccgtacgtcagtaaacggctctga

DBGET integrated database retrieval system