KEGG   Haloterrigena turkmenica: Htur_2784Help
Entry
Htur_2784         CDS       T01154                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00051  Fructose and mannose metabolism
htu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Htur_2784
Enzymes [BR:htu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Htur_2784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II DUF835
Motif
Other DBs
NCBI-ProteinID: ADB61657
UniProt: D2RXD3
Position
complement(2857129..2857770)
Genome map
AA seq 213 aa AA seqDB search
MTLEDERRAVVEHAPDLAALTPGRTGNLSVRDGETGDAFAITPTGVPYDGFDAADVPVVG
VDGDRRDGEMAPSSEVPMHAAIYRREDVGAIVHTHSPWSTTLAVAREPLPPIHYMIVAVG
KRVPVAEYAPYGTDELAEHIVRAMDEAEATATLIENHGLVVTASDVETALENTHHVESLA
RLYLQTRAAGLEPRTLSDEQLETVLEKFESYGQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgaggacgagcgccgagcagtggtcgagcacgcgccggatctcgccgcgttg
acgccgggccggacgggcaacctgagcgttcgcgacggcgagaccggcgacgccttcgcg
atcacgccgaccggcgtcccgtacgatgggttcgacgccgcggacgtcccggtcgtcggc
gtcgacggcgaccggcgcgacggcgagatggccccgagcagcgaagtgccgatgcacgcc
gcgatctaccggcgtgaggacgtcggcgcgatcgtccacactcactcgccgtggtcgacg
acgctggcggtcgcccgcgagccgctgccgccgatccactacatgatcgtcgcggtcggc
aagcgcgtccccgtcgccgagtacgcgccctacggcaccgacgagttggccgaacacatc
gtccgggcgatggacgaggccgaggcgaccgcgacgctcatcgaaaaccacggcctcgtc
gtcacggcgtcggacgtagagaccgcactcgagaacacccaccacgtcgagagcctggct
cggctgtacctccagacccgtgccgccggcctcgagccgcggacgctgtcggacgagcag
ttggagacggtgctcgagaagttcgagtcctacgggcagtag

DBGET integrated database retrieval system