KEGG   Haloterrigena turkmenica: Htur_2867Help
Entry
Htur_2867         CDS       T01154                                 

Definition
alcohol dehydrogenase GroES domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Htur_2867
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_2867
  Lipid metabolism
   00071 Fatty acid degradation
    Htur_2867
  Amino acid metabolism
   00350 Tyrosine metabolism
    Htur_2867
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Htur_2867
   00626 Naphthalene degradation
    Htur_2867
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Htur_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2939272..2940357
Genome map
AA seq 361 aa AA seqDB search
MRAAVLEAYGEPLSIESVEPPELAPHGVIVDVEACGICRSDWHAWQGHGEWADDQVPLGQ
ILGHEPAGRVARVGDDVETLAVGDRVAVPFNLGEGSCYQCRNGHGNVCEDGYALGFESSV
PGAFAEQVHVPHAEFNVTTLPDGVSPEAVAALGCRYVTAFHALAHRADIDAGDWVAVHGC
GGLGLAAVQIATALGGRVIAVDVREEPLEMAADLGAEETIDASALEDGENVPDAIDAITD
RGAHVSVDALGRAETCRNSVDCLRIRGTHVQIGLTTSAEKGEVALPIDEMTRWDVTVVGS
RGMPPSRYDELLRMIEGGRLEPEQLVTRRVGLEDVSDRLAAMSDYETSGVEVVTAFSSSS
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgctgtactcgaggcctacggcgaaccgctgtcgatcgagtcggtcgaaccg
cccgaactcgcgcctcacggcgtcatcgtcgacgtcgaggcctgcggtatctgccgaagc
gactggcacgcctggcagggccacggcgagtgggccgacgatcaggtaccgctcggacag
atcctcggccacgaacccgcgggccgagtcgcgcgggtcggcgacgacgtcgagacgctc
gcggtcggcgaccgcgtcgccgtcccgttcaacctcggcgaggggtcgtgctatcagtgt
cgcaacggccacggcaacgtctgcgaggacggctacgcgctcggcttcgaatcgagcgtt
cccggcgcgttcgccgagcaggttcacgtgccccacgccgagttcaacgtcacgacgctg
cccgacggcgtctccccggaagcggtcgccgcgctcggctgtcggtacgtcacggcgttt
cacgcgctcgcacaccgggccgatatcgacgcgggcgactgggtcgccgttcacggctgt
ggcggcctcggtctcgcggccgtccagatcgcgaccgcgctgggaggacgggtgatcgcg
gtcgacgtccgcgaggagcccctcgagatggccgccgatctgggcgccgaggagacgatc
gacgcctcagcgctcgaggacggcgagaacgtcccggacgctatcgacgcgatcaccgac
aggggagcccacgtctccgtcgacgcgctcgggcgcgccgaaacctgccgcaacagcgtc
gactgcctccgcatccgcggcacgcacgtccagatcgggctgacgaccagcgccgagaag
ggagaagtcgcactgcccatcgacgagatgacccgctgggacgtcaccgtcgtcggctcc
cgcgggatgccgccctcccggtacgacgaactgctcaggatgatcgagggcggccgactc
gagccggagcaactggtcacgcgacgcgtcggactcgaggacgtctcggatcgactcgcg
gcgatgagcgactacgagaccagtggcgtcgaggtcgtcacggcgttttcgtcctcgagc
gagtga

DBGET integrated database retrieval system