KEGG   Haloterrigena turkmenica: Htur_2963Help
Entry
Htur_2963         CDS       T01154                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Htur_2963
Enzymes [BR:htu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Htur_2963
Exosome [BR:htu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Htur_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3047115..3048656
Genome map
AA seq 513 aa AA seqDB search
MTESTYVGAVDQGTTGTRFIVFDHGGQVVANAYETHEQIYPEPGWVEHDPMEIWENTKSV
ITQALGQAGISPDQLEAIGVTNQRETTLLWDADSGRPVHNAIVWQDRRTTDRVEQLEAEE
KVEMIREKTGLEADAYFSATKAEWLLDNADPIKLERSRPEDIHDRAEKGEVLFGTIDSWL
IYNLTGEHITEVTNASRTMLYNIHDLEWDDDLLAEFGVPEAMLPEVRPSSDDDTYGTTDP
DGFLEAEIPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFFLMNTGSEAVASDHGLLTT
IAFQKSGEDVQYALEGSIFITGAAIEWLEDLSLIDNPAQTAELARSVDSTDGVYVVPAFT
GLGAPHWDQRARGTIVGMTRGTRREHIVRATLESIAYQTRDVAEAMEADSGIEMTSLKVD
GGAVKNNYLCQLQSDIIGSEIVRPVVDETTALGSAYAAGLAVGYWDDVDSLRDNWQIDRE
FEPEMDADRADKRYARWTEAVDRARDWARDDEE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaatccacgtacgtcggtgcggtagaccagggaacgaccgggacgcgctttatc
gtgttcgatcacggcggccaggtcgtcgcgaacgcctacgaaacgcacgaacagatctat
cccgaacccggctgggtcgagcacgacccgatggagatctgggagaacaccaagagcgtc
atcacgcaggcgctcgggcaggcggggatcagccccgaccagcttgaggccatcggcgtg
accaaccagcgcgagacgacgctgctgtgggacgccgactccggccggccggtccacaac
gccatcgtctggcaggaccggcgcacgaccgaccgcgtcgagcaactcgaggcggaggaa
aaggtcgagatgatccgcgagaagaccggcctcgaggccgacgcctacttctcggcgacg
aaagccgagtggctgctggacaacgccgatccgatcaagctcgagcgctcccgtcccgag
gacatccacgaccgcgcggagaagggcgaggtgctgttcgggacgatcgatagctggctg
atctacaaccttaccggcgagcacatcaccgaggtcacgaacgcctcgcggacgatgctg
tacaacatccacgacctcgagtgggacgacgacctcctcgcggagttcggcgttcccgag
gcgatgctccccgaggttcggccgtccagcgacgacgacacctacgggacgaccgatccg
gacgggttcctcgaggccgaaatccccgtcgcgggggcgctcggcgaccagcaggccgcg
ctgttcggccagacctgtttcgacgccggcgacgcgaagaacacctacggcaccggttcc
ttcttcctgatgaacaccggcagcgaggccgtcgcgagcgatcacggcctcctgacgact
atcgcgttccagaagtcgggcgaggacgtccagtacgcgctggagggctcgatcttcatc
accggcgcggcgatcgagtggctcgaggacctctcgctgatcgacaatccggcgcagacg
gccgagctcgcccgcagcgtcgactcgacggacggcgtctacgtcgtccccgcgttcacc
ggactgggcgcgccccactgggaccagcgcgctcgcggtaccatcgtcggcatgactcga
ggcacccggcgagaacacatcgtccgggcgaccctggagtcgatcgcctaccagacccgc
gacgtcgcggaggcgatggaggccgactcgggcatcgagatgacctcgctgaaggtcgac
ggcggcgcggtcaagaacaactacctctgtcagctccagtccgacatcatcggctcggag
atcgtccgtccggtcgtcgacgagacgacggcgctcgggtccgcgtacgccgccggactg
gccgtgggctactgggacgacgtcgacagcctgcgggacaactggcagatcgatcgcgag
ttcgaacccgagatggacgccgatcgagccgacaaacgctacgcgcgctggacggaagcg
gtcgaccgggcgcgcgactgggcacgggacgacgaggagtaa

DBGET integrated database retrieval system