KEGG   Haloterrigena turkmenica: Htur_2963Help
Entry
Htur_2963         CDS       T01154                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:htu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3047115..3048656
Genome map
AA seq 513 aa AA seqDB search
MTESTYVGAVDQGTTGTRFIVFDHGGQVVANAYETHEQIYPEPGWVEHDPMEIWENTKSV
ITQALGQAGISPDQLEAIGVTNQRETTLLWDADSGRPVHNAIVWQDRRTTDRVEQLEAEE
KVEMIREKTGLEADAYFSATKAEWLLDNADPIKLERSRPEDIHDRAEKGEVLFGTIDSWL
IYNLTGEHITEVTNASRTMLYNIHDLEWDDDLLAEFGVPEAMLPEVRPSSDDDTYGTTDP
DGFLEAEIPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFFLMNTGSEAVASDHGLLTT
IAFQKSGEDVQYALEGSIFITGAAIEWLEDLSLIDNPAQTAELARSVDSTDGVYVVPAFT
GLGAPHWDQRARGTIVGMTRGTRREHIVRATLESIAYQTRDVAEAMEADSGIEMTSLKVD
GGAVKNNYLCQLQSDIIGSEIVRPVVDETTALGSAYAAGLAVGYWDDVDSLRDNWQIDRE
FEPEMDADRADKRYARWTEAVDRARDWARDDEE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaatccacgtacgtcggtgcggtagaccagggaacgaccgggacgcgctttatc
gtgttcgatcacggcggccaggtcgtcgcgaacgcctacgaaacgcacgaacagatctat
cccgaacccggctgggtcgagcacgacccgatggagatctgggagaacaccaagagcgtc
atcacgcaggcgctcgggcaggcggggatcagccccgaccagcttgaggccatcggcgtg
accaaccagcgcgagacgacgctgctgtgggacgccgactccggccggccggtccacaac
gccatcgtctggcaggaccggcgcacgaccgaccgcgtcgagcaactcgaggcggaggaa
aaggtcgagatgatccgcgagaagaccggcctcgaggccgacgcctacttctcggcgacg
aaagccgagtggctgctggacaacgccgatccgatcaagctcgagcgctcccgtcccgag
gacatccacgaccgcgcggagaagggcgaggtgctgttcgggacgatcgatagctggctg
atctacaaccttaccggcgagcacatcaccgaggtcacgaacgcctcgcggacgatgctg
tacaacatccacgacctcgagtgggacgacgacctcctcgcggagttcggcgttcccgag
gcgatgctccccgaggttcggccgtccagcgacgacgacacctacgggacgaccgatccg
gacgggttcctcgaggccgaaatccccgtcgcgggggcgctcggcgaccagcaggccgcg
ctgttcggccagacctgtttcgacgccggcgacgcgaagaacacctacggcaccggttcc
ttcttcctgatgaacaccggcagcgaggccgtcgcgagcgatcacggcctcctgacgact
atcgcgttccagaagtcgggcgaggacgtccagtacgcgctggagggctcgatcttcatc
accggcgcggcgatcgagtggctcgaggacctctcgctgatcgacaatccggcgcagacg
gccgagctcgcccgcagcgtcgactcgacggacggcgtctacgtcgtccccgcgttcacc
ggactgggcgcgccccactgggaccagcgcgctcgcggtaccatcgtcggcatgactcga
ggcacccggcgagaacacatcgtccgggcgaccctggagtcgatcgcctaccagacccgc
gacgtcgcggaggcgatggaggccgactcgggcatcgagatgacctcgctgaaggtcgac
ggcggcgcggtcaagaacaactacctctgtcagctccagtccgacatcatcggctcggag
atcgtccgtccggtcgtcgacgagacgacggcgctcgggtccgcgtacgccgccggactg
gccgtgggctactgggacgacgtcgacagcctgcgggacaactggcagatcgatcgcgag
ttcgaacccgagatggacgccgatcgagccgacaaacgctacgcgcgctggacggaagcg
gtcgaccgggcgcgcgactgggcacgggacgacgaggagtaa

DBGET integrated database retrieval system