KEGG   Haloterrigena turkmenica: Htur_3069Help
Entry
Htur_3069         CDS       T01154                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_3069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_3069
   00052 Galactose metabolism
    Htur_3069
   00500 Starch and sucrose metabolism
    Htur_3069
   00520 Amino sugar and nucleotide sugar metabolism
    Htur_3069
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Htur_3069
   00524 Butirosin and neomycin biosynthesis
    Htur_3069
Enzymes [BR:htu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Htur_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148397..3149368)
Genome map
AA seq 323 aa AA seqDB search
MDYYAGVDLGATNVRAVVAEDDGTTIGVSRRSTPRGPTGIDVTEGVLRTLREACGDAGIA
PTEIVAAGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPISKLIDSDEVYLHNDTNAGV
IGERFHADRNPDDMVYITISSGVGAGVCCDGEIMSGWDGNAGEVGHCVVDPQGRLTCGCG
REGHWEAYCSGNAIPDFARLLAEDDPTISTDLPLEGPDFTAKDVFELAGEDELADYTIEQ
LAHWNAVGVTNVIHSFAPIVVSFGGAVALHNEELVVDPIRERVSEMVMTNVPEITVTDLG
DDVVLEGALASALTGGTGDRKQL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggactactatgcgggcgtcgatctcggtgcgacgaacgtccgtgccgtcgtcgccgag
gacgacgggacgacgatcggtgtgagccgacgatccacaccgcgtggcccgacggggatc
gacgtcacggaaggcgttttgcggacgcttcgcgaagcgtgtggcgacgccggtatcgca
cccacggaaatcgtcgcggcggggatcggctcaatcggcccgttcgacctcgcggaaggg
gcggtcatcgatccggcgaacctgccggactcgatcgatcgcatcccgctaacgggaccg
atatcgaaactgatcgacagcgacgaggtgtacctccacaacgacaccaacgcgggcgtc
atcggcgagcggttccacgccgaccgcaaccccgacgacatggtttacatcacgatctcc
tcgggggtcggcgccggcgtctgctgtgacggcgagatcatgagcggctgggacggcaac
gccggcgaggtcggccactgcgtcgtcgatccgcagggtcggctgacctgtggctgcggc
cgcgagggccactgggaggcctactgttcgggcaacgcgatccccgacttcgcccggctg
ctcgccgaggacgatccgaccatctcgaccgatctccccctcgagggccccgatttcacg
gccaaggacgtcttcgaactggccggcgaggacgaactggccgactacaccatcgagcaa
ctcgcccactggaacgcggtcggtgtgacgaacgtgatccactccttcgccccgatcgtc
gtctccttcggcggcgccgtcgccctccacaacgaggaactggtcgtcgaccccatccgc
gagcgcgtctccgagatggtgatgaccaacgtccccgagatcacggtcaccgatctgggc
gacgacgtcgtcctcgagggcgccctcgccagcgcgctgaccggcggcacgggcgaccgc
aagcagctctga

DBGET integrated database retrieval system