KEGG   Haloterrigena turkmenica: Htur_3104Help
Entry
Htur_3104         CDS       T01154                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
htu  Haloterrigena turkmenica
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Htur_3104
Enzymes [BR:htu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Htur_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3186226..3187074
Genome map
AA seq 282 aa AA seqDB search
MFPGATDDGEGSHTAGETDRDGANFVVVGAPLDVSTTFQPGTRFGPRRIRTFAEPFDDYD
HRRDQYFSDLGVEDHGDVRAWDNAKEYLEYLEGTLRGVVWDDAVPLTLGGEHTVSLAGVR
AVEPEVVVVLDAHLDLYEAYDGNALSHASVTRRILEVDSVDDVFVLGARTGSEAEWERAR
EPDVTVVPPEDVADWPLADRLDGRDAYLSVDIDAADPAYAPGTGTREPFGLESRELRDVV
RAVAPQANGFDVVEVNDRDEGQTAALAGKLVREFVFSHADGW
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggggcgaccgacgacggcgaggggagccacacggcgggcgagaccgaccgt
gacggcgcgaacttcgtggtcgtcggtgcgcccctggacgtatcgacgacctttcagccg
gggacccgattcggtccccgacgcattcgaacttttgccgaaccgttcgacgactacgac
caccggagggaccagtacttctccgacctcggcgtcgaggaccacggcgacgtccgcgcg
tgggacaatgccaaagagtacctcgagtacctcgaggggacgctgcgcggtgtcgtctgg
gacgacgccgtcccgctgacgctcggcggggaacacaccgtctcgctggcgggcgttcgc
gccgtcgaacccgaggtagtcgtcgtgctcgacgcccacctcgacctctacgaggcctac
gacggcaacgcgctctctcacgcctccgtcacccgacggatcctcgaggtcgattccgtc
gacgacgtgttcgtcctcggcgctcggaccggcagcgaggcggagtgggagcgggcccga
gaaccggacgtgacggtcgtcccacccgaagacgtcgccgactggccgttagcggatcga
ctggacggtcgcgacgcctacctgagcgtcgacatcgacgccgccgacccagcctacgcg
ccggggaccggaaccagagagccgttcggcctcgagtcccgcgagctgcgcgacgtcgtc
cgcgcggtcgcaccgcaggcgaacggcttcgacgtcgtcgaggtcaacgaccgcgacgag
ggacagaccgcggcgctggccgggaaactcgtccgtgagttcgtcttctcacacgccgac
ggctggtag

DBGET integrated database retrieval system