KEGG   Haloterrigena turkmenica: Htur_3184Help
Entry
Htur_3184         CDS       T01154                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Htur_3184
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Htur_3184
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Htur_3184
Enzymes [BR:htu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Htur_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3272067..3273218
Genome map
AA seq 383 aa AA seqDB search
MSDGAFEGYGGRHVPDLLQDPLEQLATAYDEVADTDDFQSELRGLLEEFAGRPTPLYHAS
NLSDRYGAEIYLKREDLLHGGAHKINNALGQALLAKRAGRERLIAETGAGQHGTATAMVG
ALLDLETEIYMGKKDVERQEMNAFRMRLMGAEVNEVTRGGEGLADAVDAALEDFAENVEN
THYLVGSVVGPDPFPRMVRDFQSVIGREAREQFQNRTGELPDAAVACVGGGSNAIGLFHA
FREDDVDFYGAEGGGEGSDSNRHAAPLAQGKDDVIHGMKTRVLDDDVEVHSVSAGLDYPG
VGPEHAMFRAIGRCEYTGITDEEALAAFRELSETEGIIPALESSHAIARAIQLAEDGDHE
TILVNLSGRGDKDMETAASKFEL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggcgctttcgagggatacggcggacgacacgtccccgacctcctgcaggac
ccactcgagcagctcgcgaccgcctacgacgaggtcgccgataccgacgacttccaatcg
gaactgcgcgggctcctcgaggagttcgccgggcgaccgacgccgctgtaccacgccagc
aatttgagcgaccggtacggcgccgagatctacctcaagcgagaggacctgctccacggc
ggcgcacacaagatcaacaacgcgctcggccaggccctgctggccaagcgggctggccgc
gagcggctcatcgccgagaccggcgccggccagcacggcaccgcgaccgcgatggtcggc
gccctgctggacctcgagacggagatctacatggggaagaaagacgtcgagcgccaggag
atgaacgccttccggatgcggctgatgggcgccgaggtcaacgaggtgacccgcggcggc
gaagggttggccgacgccgtcgacgcggccctcgaggacttcgcggagaacgtcgagaac
actcactacctcgtgggcagcgtcgtcggtcccgacccgttcccgcggatggtccgggac
ttccagagcgtcatcggtcgcgaggctcgcgagcagtttcagaaccggacgggcgagttg
cccgacgccgcagtcgcctgcgtcggaggtggctcgaacgccatcgggctcttccacgcc
ttccgcgaggacgacgtcgacttctacggcgccgagggcggcggcgaggggagcgactcg
aaccgccacgccgcgccgctggcacaggggaaagacgacgtcatccacgggatgaagacg
cgcgtgctcgacgacgacgtcgaggtccactcggtctccgcgggactcgactacccgggt
gtcggccccgaacacgccatgttccgcgccatcgggcggtgtgagtacaccgggatcacc
gacgaggaagccctcgccgcgttccgcgaactgagcgagaccgaggggatcatcccggct
ctcgagtccagccacgcgatcgcgcgggcgatccagttggccgaggacggcgaccacgag
acgatcctcgtcaacctctccggccggggcgacaaggacatggagaccgcggcctcgaaa
ttcgagctatag

DBGET integrated database retrieval system