KEGG   Haloterrigena turkmenica: Htur_3184Help
Entry
Htur_3184         CDS       T01154                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Htur_3184
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Htur_3184
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Htur_3184
Enzymes [BR:htu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Htur_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3272067..3273218
Genome map
AA seq 383 aa AA seqDB search
MSDGAFEGYGGRHVPDLLQDPLEQLATAYDEVADTDDFQSELRGLLEEFAGRPTPLYHAS
NLSDRYGAEIYLKREDLLHGGAHKINNALGQALLAKRAGRERLIAETGAGQHGTATAMVG
ALLDLETEIYMGKKDVERQEMNAFRMRLMGAEVNEVTRGGEGLADAVDAALEDFAENVEN
THYLVGSVVGPDPFPRMVRDFQSVIGREAREQFQNRTGELPDAAVACVGGGSNAIGLFHA
FREDDVDFYGAEGGGEGSDSNRHAAPLAQGKDDVIHGMKTRVLDDDVEVHSVSAGLDYPG
VGPEHAMFRAIGRCEYTGITDEEALAAFRELSETEGIIPALESSHAIARAIQLAEDGDHE
TILVNLSGRGDKDMETAASKFEL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggcgctttcgagggatacggcggacgacacgtccccgacctcctgcaggac
ccactcgagcagctcgcgaccgcctacgacgaggtcgccgataccgacgacttccaatcg
gaactgcgcgggctcctcgaggagttcgccgggcgaccgacgccgctgtaccacgccagc
aatttgagcgaccggtacggcgccgagatctacctcaagcgagaggacctgctccacggc
ggcgcacacaagatcaacaacgcgctcggccaggccctgctggccaagcgggctggccgc
gagcggctcatcgccgagaccggcgccggccagcacggcaccgcgaccgcgatggtcggc
gccctgctggacctcgagacggagatctacatggggaagaaagacgtcgagcgccaggag
atgaacgccttccggatgcggctgatgggcgccgaggtcaacgaggtgacccgcggcggc
gaagggttggccgacgccgtcgacgcggccctcgaggacttcgcggagaacgtcgagaac
actcactacctcgtgggcagcgtcgtcggtcccgacccgttcccgcggatggtccgggac
ttccagagcgtcatcggtcgcgaggctcgcgagcagtttcagaaccggacgggcgagttg
cccgacgccgcagtcgcctgcgtcggaggtggctcgaacgccatcgggctcttccacgcc
ttccgcgaggacgacgtcgacttctacggcgccgagggcggcggcgaggggagcgactcg
aaccgccacgccgcgccgctggcacaggggaaagacgacgtcatccacgggatgaagacg
cgcgtgctcgacgacgacgtcgaggtccactcggtctccgcgggactcgactacccgggt
gtcggccccgaacacgccatgttccgcgccatcgggcggtgtgagtacaccgggatcacc
gacgaggaagccctcgccgcgttccgcgaactgagcgagaccgaggggatcatcccggct
ctcgagtccagccacgcgatcgcgcgggcgatccagttggccgaggacggcgaccacgag
acgatcctcgtcaacctctccggccggggcgacaaggacatggagaccgcggcctcgaaa
ttcgagctatag

DBGET integrated database retrieval system