KEGG   Haloterrigena turkmenica: Htur_3284Help
Entry
Htur_3284         CDS       T01154                                 

Definition
dihydropteroate synthase (EC:6.3.2.17 2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
htu  Haloterrigena turkmenica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:htu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3375553..3378096)
Genome map
AA seq 847 aa AA seqDB search
MEYHEAADFLFDLRRFRPKPGTESTARLLAHLGDPHDGVEFVQIAGSNGKGSTARMVERS
LREAGLSVGLYTSPHLEDLRERIRVDGRKIPRSAVREFVEAAHEYLTDRGADGESPTFFE
TMTAMAVWQFGREDVDVAVLEVGIGGKYDATSVVDPVASAVTSVTLEHTGILGDTVGEIA
RDKAHVAPADAPLVTGTTGDALEGVREVAGDVITVGAADADRDDEPDVRVAYGGRVNHTE
AAVTVEHGDWTLENRLSLLGAHQAENAGIAAVLARQVADISDDDLARGLRSAHWPGRFEV
LETTPLIVLDGAHNPGACEPLAATLDTYDYDDLHLVFGAMHDKDHREMAATLPTPDVVVA
TEPPLDRAEDRDVLASVFEDVGVADVRTSATVQDALETALREADDNDCVLVTGSLFAVAE
ARSRWTNAGVPKRIRDREDAREALSTANVPAASDSELQGDAVHRVVSLSLGYRRATAVER
ELLRLGGECALSGLQRDEESVDAVLMGTVTQFERLVERLESGPGPTDRSDDGTRGLLEVA
RELRERLEIDSEADSSDGPTAVTAGTTGADGADAGHPWDDRTAVMGILNVTPDSFHDGGE
YDALEDAVARAERMIENGVDVIDVGGESTRPGADPVPTEAEIDRVVPVVEEIADLDALVS
IDTRKAAVAEAALEAGADIINDVSGLEDPEMRFVVADHDAMLVLMHSIDAPVVPGREIEY
DDVVEDVIDRLSERILLAEKAGIDREDIIVDPGIGFGKSAPEAFELLDRTDEFRALGCPI
LIGHSHKSMFEHVGRETGERTAATVAASAIAADRGADIVRVHDVPENVAAVRTALAARNP
ERFDWQP
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcacgaggcggcggatttcttattcgatctgcggcgctttcgccccaaaccg
gggacggagtcgacggcgcggctgctcgcccacctcggcgacccccacgacggggtcgag
ttcgtgcagatcgccggctccaacggcaaggggagtacggcgcggatggtcgagcgaagc
ctccgggaggccgggctctcggtcggcctctacacctcgccccacctcgaggacttgcgc
gagcggatccgcgtcgacggccggaagatcccccgctcggcggtccgcgaattcgtcgag
gcggctcacgagtaccttaccgaccggggcgccgacggcgagtcgccgacgttcttcgag
acgatgaccgccatggccgtctggcagttcggtcgcgaggacgtcgacgtcgccgtcctc
gaggtcggcatcggcgggaagtacgacgccacgagcgtcgtcgaccccgtcgcgagcgcg
gtcacaagcgtcacactagagcacacgggcatcctcggcgacaccgtcggcgagatcgcc
cgcgacaaggcccacgtcgcgcccgccgacgcgccgctggtgaccggaaccaccggcgac
gccctcgagggagtccgtgaggtcgcgggcgacgtgatcaccgtcggggccgcagacgcc
gatcgcgacgacgagcccgacgttcgcgtcgcatacggcggccgcgtgaaccacaccgaa
gccgccgtcaccgtcgaacacggcgactggaccctcgaaaaccgactctcgctgctgggg
gcccaccaggccgagaacgcagggatcgccgccgtcttggcccggcaggtcgccgatatt
tcggacgacgacctcgcacgcgggctgcgaagtgcccactggcccggccgattcgaggtc
ctcgagacgacgccgctgatcgtcttagacggtgcgcacaaccccggcgcctgcgagccg
ctcgcggcgacgctcgacacctacgactacgacgacctccacctcgtcttcggggcgatg
cacgacaaggaccaccgcgagatggccgcgacgctgccgacgcccgacgtggtcgtcgcg
accgagccgcccctcgaccgcgccgaggaccgcgacgtcctcgcgagcgtgttcgaagac
gtcggcgtcgccgacgtccgaacgtcagccaccgtccaggacgccctcgagaccgctctc
cgcgaggccgacgacaacgactgcgtgctcgtgacgggctcgctgttcgccgtcgccgag
gcccgctcgcgctggacgaacgccggggttccgaaacggattcgcgaccgcgaggacgcc
cgcgaggcgctttcgacggcgaacgtacccgccgcgagcgattcggaactgcagggcgac
gccgtccaccgcgtcgtctcgctctcgctcggctaccgacgggccacggccgtcgaacgg
gaactgctgcgactgggcggcgagtgcgctctctcgggactccagcgcgacgaggagtcg
gtcgacgccgtcctgatgggtaccgtcacccagttcgaacgcctcgtcgagcgcctcgag
tccggccccgggccgacggaccgctcggacgacggcacacgcggtctgctcgaggtcgcc
cgggaacttcgcgagcgccttgagatcgattcggaggcggactcgagcgatgggcccaca
gcagtcacggccgggactaccggcgccgacggcgccgacgcgggccatccttgggacgac
cgcaccgccgtcatgggcattctgaacgtcacgccggacagcttccacgacggcggcgag
tacgacgccctcgaggacgccgtcgcccgcgccgaacggatgatcgagaacggcgtcgac
gtgatcgacgtcggcggcgagtcgacccgtcccggcgccgacccggtgccgaccgaggcg
gagatcgaccgcgtcgtccccgtcgtcgaggagatcgcggacctcgacgccctcgtctcg
atcgacacccggaaggccgccgtcgccgaggccgctctcgaggccggcgcggacatcatc
aacgacgtctcgggactcgaggaccccgagatgcgcttcgtcgtcgccgaccacgacgcg
atgctggtgctgatgcacagcatcgacgcgccggtcgtgccgggccgcgagatcgagtac
gacgacgtcgtcgaggacgtgatcgaccggctctccgagcggattctcctcgcggagaag
gccggcatcgaccgcgaggacatcatcgtcgatccggggatcggcttcggcaagtcggct
cccgaggccttcgaactcctcgatcgcaccgacgagttccgggcgcttggctgtccgatc
ctgatcggccactcccacaagtcgatgttcgaacacgtcggccgcgagaccggcgagcgc
accgcggcgaccgtcgcagcgagcgcgatcgcggccgaccggggcgccgacatcgttcgg
gtccacgacgttcccgagaacgtcgctgcagttcggacggcgctcgcggcacggaatccg
gaacggttcgactggcagccctga

DBGET integrated database retrieval system