KEGG   Haloterrigena turkmenica: Htur_3571Help
Entry
Htur_3571         CDS       T01154                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
htu  Haloterrigena turkmenica
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:htu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3674874..3675644
Genome map
AA seq 256 aa AA seqDB search
MELEPVTGLPEVRPGDDIAELVAERVDLEPGDVLTVASTIVSKAEGRLADLEDYPVSGRA
QEIADRIEEIAGEEKDPRFAQAVLDESAELLIDVPFLLAETRFGHICPNAGIDRSNVPDH
DILLLPRKPSESAERICAGLEERGYEDVPVIVTDTCGRPFRHGQTGVAIGWAGMPASRDW
RGEADRDGHELGVTVQSVVDELAAAANLVTGEGAGGVPAVAVRDWEFGDHDGSDELFRAV
ENDLVREALRDWEFDG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgaaccagtgacgggcctgccagaggtccgtcccggcgacgacatcgccgaa
ctcgtcgcggagcgggtcgacttagagcccggtgacgtgctcaccgtcgcgagcacgatc
gtctcgaaggccgagggacgactggcggatctcgaggactatcccgtcagcggccgggca
caggagatcgccgaccggatcgaggagatcgccggcgaggagaaggacccgcggttcgca
caggccgtcttagacgagagcgcggagctgttgatcgacgtcccgttcctgctggccgag
acgcgattcggccacatctgtccgaacgcggggatcgatcggtcgaacgtgccggaccac
gacatcctcctgctgcccagaaagccaagcgagagcgccgagcgcatctgcgcgggactc
gaggaacggggctacgaggacgtccctgtgatcgtcaccgacacctgcggacgcccgttc
cgacacggccagaccggcgtcgcgatcggctgggccggcatgcccgccagccgggactgg
cgcggcgaggcggaccgcgacggccacgaactcggcgtcaccgtccagtcggtggtcgac
gaactcgctgccgccgcaaatctcgtaaccggcgagggcgcgggcggcgtccccgcggtg
gccgtccgcgactgggagttcggcgaccacgacggcagcgacgaactgttcagagcggtc
gagaacgacctcgttcgggaagcgcttcgggactgggagttcgacggctga

DBGET integrated database retrieval system