KEGG   Haloterrigena turkmenica: Htur_3677Help
Entry
Htur_3677         CDS       T01154                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
htu  Haloterrigena turkmenica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:htu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3788965..3789732
Genome map
AA seq 255 aa AA seqDB search
MSEAEPSEATDRPTVAVFRPDDERLESAAALLSELGAEPVPDPMLAVEATGATPRTDADY
VVFTSKTGAELVSEAGWEPGDQTVCAIGPATADALRAEGYAVDLVPEKFTSSGLVAALED
RVAGARIEVARSDHGSAVLLDGFEDAGAYVHETILYRLVRPDGSGKSAALAAEGDLDAVC
FTSSLTVDHFLEAAADRGVRDAALEGLAAATVGVIGEPTAETAAERGIDVDVVPKEATFD
ALARETVAAVRPGRE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcagaaccgtccgaggcgaccgacagacccaccgtcgccgtcttccgcccc
gacgacgagcgcctcgagtcggccgcggccctgctctccgaactcggcgccgagccggtt
ccggacccgatgctggccgtcgaggcgaccggcgcgaccccgcggaccgacgccgactac
gtcgtcttcacgagcaagaccggcgcggaactcgtctctgaagcgggctgggagcccggc
gatcagaccgtctgtgccatcggccccgcgacggccgacgcgctccgcgcggaggggtac
gcggtcgatctcgtccccgagaagttcacctcgagcggcctcgtcgccgccctggaagac
cgcgtcgcgggcgcccgcatcgaggtcgcccgcagcgaccacggcagcgcggtcctgctc
gacggcttcgaggacgcgggcgcgtacgtccacgagacgatcctctaccggctggtccgt
cccgacggcagcggcaagtcggccgcgttggccgccgagggcgacctcgacgccgtctgc
ttcacctcgtcgctgaccgtcgaccacttcctcgaggccgcggccgaccgaggggttcgg
gacgcggcgctcgaggggctcgccgcggccaccgtcggcgtcatcggcgagccgacggcc
gagaccgccgccgagcggggaatcgacgtcgacgtcgtgcccaaggaagccacgttcgac
gcgctcgcgcgggagacggtcgcggccgtccgacccggtcgcgagtaa

DBGET integrated database retrieval system