KEGG   Haloterrigena turkmenica: Htur_3740Help
Entry
Htur_3740         CDS       T01154                                 

Definition
alcohol dehydrogenase GroES domain protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Htur_3740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_3740
  Lipid metabolism
   00071 Fatty acid degradation
    Htur_3740
  Amino acid metabolism
   00350 Tyrosine metabolism
    Htur_3740
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Htur_3740
   00626 Naphthalene degradation
    Htur_3740
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Htur_3740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3855339..3856382
Genome map
AA seq 347 aa AA seqDB search
MQAARLHEYTDEMSEALRVEEIDRPDLERSDQILVEVEGAGWCQTDNHIIEGMWADYAPQ
DLPMTLGHENAGFVTETGEEVTLVEEGDPVICHPVQTCGICRPCRLGEDMYCENSAFNGL
TTDGGFAEYLQTNERAVIPLPDGVDPTEIAPHADAGITAYHAVKKAVDELNPGDTCVVVG
VGGLGHIGLQCLEAMSAADIVAADIKDEALELAEDLGARHTVNSAEEDLADAIGELTDDE
GAQQVIDFVGSDETTGLAADVVAAGGDHHIVGYGGHIHEPSQALVDGEFSFRGTLVGKYA
ELQELVALVDRGDVELRTERHDLDEINTVAERLEHNEIEGRAVIQPP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagccagactccacgagtacaccgacgagatgagcgaggcgctgcgggtcgag
gagatcgaccgacccgacctcgagcgatccgaccagatactggtcgaagtcgagggcgcg
ggctggtgccagacggacaaccacatcatcgaggggatgtgggccgactacgcaccacag
gacctaccgatgacgcttggtcacgagaacgccggtttcgtcaccgagaccggcgaggag
gtgacgctggtcgaggagggcgatccggtgatctgtcaccccgtccagacgtgtggcatc
tgtcggccctgtcggctcggtgaggacatgtactgcgagaacagcgcgttcaacgggctc
accaccgacggcggcttcgccgagtacctgcagaccaacgagcgcgcggtgatcccgctg
cccgacggcgtcgatccgaccgagatcgccccgcacgccgacgcggggatcacggcctac
cacgcagtcaagaaggccgtcgacgaactgaaccccggcgacacctgcgtcgtcgtcggc
gtcggcggcctcggccacatcggcctccagtgtctcgaggcgatgagcgccgccgacatc
gtcgccgccgacatcaaggacgaggccctcgagctggccgaggacctgggcgctcgccac
accgtcaactccgccgaggaggacctcgcggacgcgatcggggagctgaccgacgacgag
ggggcccagcaggtgatcgacttcgtcgggagcgacgagacgaccggactcgcggccgac
gtcgtcgccgccggcggcgaccaccacatcgtcggctacggcggccacatccacgaaccc
agccaggcactggtcgacggcgagttctcgttccgtgggacgctggtcggcaagtacgcc
gaactccaggaactcgtcgccctcgtcgaccgcggcgacgtcgaactgcgaaccgaacgc
cacgatctcgacgaaatcaacacggtcgccgaacgactcgagcacaacgagatcgaaggt
cgagcggtgatccagccgccgtga

DBGET integrated database retrieval system