KEGG   Haloterrigena turkmenica: Htur_3856Help
Entry
Htur_3856         CDS       T01154                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:htu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR01:complement(82271..83368)
Genome map
AA seq 365 aa AA seqDB search
MTDHDHADVSTAPTTARDASASRTFPFTAIVDQEEMKRALVLNAINPAIGGVLLRGERGT
AKSTAVRALAEVLPDLEVVADCPYGCPPDVPAEMCGSCRERADAGAELPVETRSMQVVDL
PLNASEDRVVGSIDLERAVQAGEREFEPGILAEANRNVLYVDEVNLLDDHLVDVLLDAAA
MGENVVEREGVSYRHPAEFILVGTMNPEEGDLRPQLLDRFGLVVDIEGVSEADDRVEISQ
RRAAFEADPEGFRERFADEQRDLRERIAAARDRLDTVEVPEDVARLIAGVNVELDIDGHR
GDITLRRAARTLAALEGESTVTPRLVRRVTRTALDHRLKRLPFEEEETDAMAAFHDVRAE
LGLED
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgaccacgccgacgtctcgaccgcaccgacgaccgcccgcgacgcgagc
gcatcgcgaacgttcccgtttaccgccatcgtcgaccaggaggagatgaagcgggcgctc
gtactcaacgcgatcaaccctgccatcggcggcgttctcctccggggggagcgcgggacg
gcgaagtcgaccgccgtccgcgcgctcgccgaggtactgccggacctcgaggtcgtcgcg
gactgtccgtacggctgtccgcccgacgttccggcagagatgtgcggctcgtgtcgcgaa
cgcgccgacgccggcgcggaactccctgtcgagacgcggtcgatgcaggtggtggacctc
ccgctgaacgcctccgaggaccgcgtcgtcggttcgatcgacctcgagcgggcggtccag
gccggcgagcgcgagttcgagcccggcattctggccgaggctaacagaaacgtactgtac
gtcgacgaggtgaacctgctcgacgaccacctcgtcgacgtgttactcgacgcggccgcc
atgggcgaaaacgtcgtcgagcgcgaaggcgtgtcgtaccgtcatccggcggagttcatc
ctcgtggggacgatgaaccccgaggagggcgaccttcgaccccagctgctcgatcgattc
ggtctcgtcgtcgatatcgagggagtcagcgaggcagacgaccgcgtcgagatcagccag
cgacgcgcggccttcgaggccgaccccgagggcttccgcgagcggttcgccgacgagcaa
cgcgacctccgggagcgcattgcggccgctcgtgaccgactcgacaccgtcgaggtgccc
gaggacgtcgccagactcatcgccggcgtgaacgtggaactggacatcgacggccaccgc
ggcgatatcacgctccgccgggcggcgcggacgctcgcggcgctggagggcgagtcgacg
gtcactccccgcctcgtcaggcgagtcacgcgaacggcgctcgaccaccgactcaagcgg
ctcccgttcgaagaggaggaaacggacgcgatggcggcctttcacgacgttcgtgcggaa
ctgggactcgaggactga

DBGET integrated database retrieval system