KEGG   Haloterrigena turkmenica: Htur_3856Help
Entry
Htur_3856         CDS       T01154                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00860  Porphyrin and chlorophyll metabolism
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Htur_3856
Enzymes [BR:htu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Htur_3856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA_16 DUF815 MCM AAA_30 AAA DPCD
Motif
Other DBs
NCBI-ProteinID: ADB62715
UniProt: D2S018
Position
pHTUR01:complement(82271..83368)
Genome map
AA seq 365 aa AA seqDB search
MTDHDHADVSTAPTTARDASASRTFPFTAIVDQEEMKRALVLNAINPAIGGVLLRGERGT
AKSTAVRALAEVLPDLEVVADCPYGCPPDVPAEMCGSCRERADAGAELPVETRSMQVVDL
PLNASEDRVVGSIDLERAVQAGEREFEPGILAEANRNVLYVDEVNLLDDHLVDVLLDAAA
MGENVVEREGVSYRHPAEFILVGTMNPEEGDLRPQLLDRFGLVVDIEGVSEADDRVEISQ
RRAAFEADPEGFRERFADEQRDLRERIAAARDRLDTVEVPEDVARLIAGVNVELDIDGHR
GDITLRRAARTLAALEGESTVTPRLVRRVTRTALDHRLKRLPFEEEETDAMAAFHDVRAE
LGLED
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgaccacgccgacgtctcgaccgcaccgacgaccgcccgcgacgcgagc
gcatcgcgaacgttcccgtttaccgccatcgtcgaccaggaggagatgaagcgggcgctc
gtactcaacgcgatcaaccctgccatcggcggcgttctcctccggggggagcgcgggacg
gcgaagtcgaccgccgtccgcgcgctcgccgaggtactgccggacctcgaggtcgtcgcg
gactgtccgtacggctgtccgcccgacgttccggcagagatgtgcggctcgtgtcgcgaa
cgcgccgacgccggcgcggaactccctgtcgagacgcggtcgatgcaggtggtggacctc
ccgctgaacgcctccgaggaccgcgtcgtcggttcgatcgacctcgagcgggcggtccag
gccggcgagcgcgagttcgagcccggcattctggccgaggctaacagaaacgtactgtac
gtcgacgaggtgaacctgctcgacgaccacctcgtcgacgtgttactcgacgcggccgcc
atgggcgaaaacgtcgtcgagcgcgaaggcgtgtcgtaccgtcatccggcggagttcatc
ctcgtggggacgatgaaccccgaggagggcgaccttcgaccccagctgctcgatcgattc
ggtctcgtcgtcgatatcgagggagtcagcgaggcagacgaccgcgtcgagatcagccag
cgacgcgcggccttcgaggccgaccccgagggcttccgcgagcggttcgccgacgagcaa
cgcgacctccgggagcgcattgcggccgctcgtgaccgactcgacaccgtcgaggtgccc
gaggacgtcgccagactcatcgccggcgtgaacgtggaactggacatcgacggccaccgc
ggcgatatcacgctccgccgggcggcgcggacgctcgcggcgctggagggcgagtcgacg
gtcactccccgcctcgtcaggcgagtcacgcgaacggcgctcgaccaccgactcaagcgg
ctcccgttcgaagaggaggaaacggacgcgatggcggcctttcacgacgttcgtgcggaa
ctgggactcgaggactga

DBGET integrated database retrieval system