KEGG   Haloterrigena turkmenica: Htur_3857Help
Entry
Htur_3857         CDS       T01154                                 

Definition
ATPase AAA
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Htur_3857
Enzymes [BR:htu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Htur_3857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR01:complement(83448..85445)
Genome map
AA seq 665 aa AA seqDB search
MAGSYPFAALVDQRPMKRALALAAVSPEIRGVLLRGERGTAKSTAVRALADLLPERAVVA
DCPYGCPSGAPAGLCDSCRERVDAGENLPTETRPMRVVDLPLNASEDRVVGSIDLERAVQ
AGEREFEPGILAEANRNVLYVDEVNLLDDHIVDVLLDAAAMGENVVERDGVSHRHPAEFI
LVGTMNPEEGDLRPQLLDRFDLVVAVTASDDPDDRVEIARRREAFEADPEGFRERFADEQ
CDLRERIAAARDRLPAMTIDDEVLSSAAYEAVRRRAHGLRADVAVNRTARAIAALEGDEA
VTEAHVTEAQYFAFPHRVEGVPEMNFGEGVLGEQGDDEAEGSDNETDRESDEDRDAAAAA
GGIPIRGDEASYPVDRTAIQPPRDRTMREALARRTPSKVDVRSGRYVRARDSESVDDVAI
DATLRAAAPHQPARRETDDSSSGIAIEPKDLRQKIRERRAEALVVFVVDASGSVMSGRQM
FETKRGILSLVEDAYRARDRVAVVVFREEGAFTLVEPTRNLSAARRAVSKLTVGGNTPLA
HGLVEAYELVERERRRDEDLYPLVVLFSDGQTNVEFREDGDAKRDAFEAAAMFADADVPS
VFVDTGYQIDTTPDEIWTERKAERIKRKRVERNLDYAAAMDADYLPLVDLPRDTVLPDDV
EVPSA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggccggatcgtatccgttcgccgcgctcgtcgatcagcgaccgatgaagcgagcgctc
gctctcgccgccgtgagtccggagatccgcggtgttctccttcggggcgagcgcgggacg
gcgaaatcgaccgccgtccgcgcgctcgccgatctcctccccgagcgagccgtcgtcgcg
gactgcccgtacggctgtccgtccggcgcgccggcagggctgtgcgactcgtgtcgcgag
cgcgtcgacgccggcgagaatctcccgacggagacgcggccgatgcgggtggtggatctc
ccgctgaacgcctccgaggaccgcgtcgtcggctcgatcgatctcgagcgagcggttcag
gccggcgagcgcgagttcgaaccgggcattctggccgaagcgaatcggaacgtgctgtac
gtcgacgaggtgaacctgctcgacgaccacatcgtcgacgtgttgctcgacgcggccgcc
atgggagaaaacgtcgtcgaacgcgacggcgtctctcaccgacacccggcggagttcatc
ctcgtggggacgatgaatcccgaggagggcgatctccggccacaactcctcgaccggttc
gatctcgtcgtcgccgtgaccgcgagcgacgacccggacgaccgcgtcgaaatcgcccgg
cggcgcgaggccttcgaggccgaccccgagggcttccgcgagcggttcgccgacgagcag
tgcgaccttcgcgagcgcatcgcggccgctcgagaccgactcccagccatgactatcgac
gacgaggtgctctcgagcgccgcctacgaggcggtccgacggcgcgcacacggtcttcgg
gccgacgtggcggtcaaccgcaccgcccgcgccatcgccgcgctcgagggcgacgaggct
gtgaccgaggcgcacgtgaccgaggcccagtacttcgcgttcccccaccgggtcgagggc
gtcccggagatgaacttcggcgagggcgtcctcggcgagcagggcgacgacgaggcggag
ggcagcgataatgagaccgaccgagagtcggacgaggatcgggacgccgccgccgcggcc
ggtgggatcccgatccgcggcgacgaagcatcgtatccggtcgatcggacggcgatccag
ccgccgcgggatcgtaccatgcgcgaggcactcgcgcggcggacgccgtcgaaggtcgac
gttcggagcgggcgatacgtccgcgctcgggacagcgagtccgtcgacgacgtggcgatc
gacgcgacgctccgggccgccgccccgcaccagcccgcccgccgggagaccgacgactcg
tcttcgggaatcgccatcgaacccaaggatctgcgccagaagatccgcgagcgccgggcc
gaggccctcgtcgtgttcgtcgtcgacgccagcggcagcgtgatgagcgggcggcagatg
ttcgagacgaagcgggggatcctctcgctcgtcgaggacgcctaccgcgcccgcgatcgc
gtcgcggtcgtcgtcttccgcgaggagggcgcgttcacgctcgtcgaacccacccggaac
ctctcggcggcgcgacgggcggtctcgaagttgactgtcggcggcaacacgccgctggcg
cacggcctcgtcgaggcgtacgaactcgtcgagcgcgaacgccgccgggacgaggacctg
tatccgctagtcgtgctgttttcggacggccagacgaacgtcgaattccgggaggacggc
gacgcgaagcgcgacgcgttcgaggccgcggccatgttcgcggacgcggacgttccgtcg
gtcttcgtcgataccggctaccagatcgacaccacgccggacgagatctggaccgagcgc
aaggccgagcgcatcaagcgaaagcgcgtcgagcggaacctcgactacgcggcggccatg
gatgcggactaccttccgctggtcgacctcccgcgtgacaccgtgttaccggacgacgtc
gaggtgccgtcggcgtga

DBGET integrated database retrieval system