KEGG   Haloterrigena turkmenica: Htur_3892Help
Entry
Htur_3892         CDS       T01154                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
htu  Haloterrigena turkmenica
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:htu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR01:128183..130192
Genome map
AA seq 669 aa AA seqDB search
MSIGVCYFPEHWPREQWETDVRQMADAGIEYVRMAEFSWRVLEPERGAFDFEWLDEIVEL
IGEYGMQAVLCTPTAAPPRWLVEERPEIRQRDRDGTVRDVGSRRHYCFNSAAYREETERV
VRAMAERYADDPRVVGWQTDNEYGCHGTTRCYCDDCADAFRDWVREEYETVDELNEAWGT
TFWSQQYDDFEQVDLPRPTPAQDHPAMLLDFARFSSDSVVKYNRLQADLLREANDEWFVT
HNFMNLFESVDTYDFDEDLDLISWDSYPTGHVQQAGGETTTDELRAGNPDLLSFNHDLYR
SVLDRPFWVMEQQPGDVNWPPHSTQPAEGAMRLWAHHATAHGADAVVYFRWRRCLEGQEQ
YHAGLRKQDGSADRGYDDATRAAEELFDLDHVDAPVALLHDYENAWALGEQPHAPDFDYW
QLLQSFYASLRAHGVQVDIVHPESDLESYDAVVAPTLHLATESLADHLTAYVESGGELLL
GPRTGVKDAHNKLRPDLQPGPLSELVGASVDQHESLPTQFEPTVAGTDGTNAEYAFRTWA
EWLEADAAEPLLEYAGDDIEGGRTAAVRNAVGEGSVVYCGVWPETDLANDLVGSLLDRAG
VRRMDVLPDGVRVARRDGHTWVLNFGSDPIAVTLEGDASWRLGGPEIGPFDLAIAETNAV
DDLSVRIRD
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcggagtctgttacttcccggagcactggccgcgcgaacagtgggagacggat
gttcggcagatggccgacgctggaatcgagtacgtccggatggcggagttctcgtggcgg
gtcctcgagcccgaacgcggcgcgttcgacttcgagtggctcgacgagatcgtcgagctg
attggcgagtacgggatgcaggccgtcctgtgtacgccgacggcggcaccgccgcggtgg
ctcgtcgaggaacgccccgagatccgccagcgagaccgtgacggaaccgtcagggacgtc
ggaagccgccggcactactgtttcaactccgcggcctatcgcgaggagaccgaacgcgtc
gtccgagcgatggcggagcgctacgccgacgatccgcgcgtcgtcggctggcagaccgac
aacgagtacggctgtcacggcacgacacggtgttactgcgacgactgcgctgacgcgttc
cgggactgggtccgcgaggagtacgagaccgtcgacgaactcaacgaagcgtggggaacg
acgttctggagccaacagtacgacgacttcgaacaggtcgacctcccgcggccgacgccc
gcgcaggaccatccggcgatgctgctcgatttcgcccgattctcgagcgacagcgtcgtc
aagtacaatcggctgcaggcggacctgcttcgcgaggcgaacgacgagtggttcgtcacg
cacaacttcatgaacctgttcgagtcggtggacacctacgacttcgacgaggacctcgat
ctgatttcctgggactcgtacccgacaggccacgtccagcaggccggcggcgagacgacg
accgacgagctccgcgcggggaaccccgatctgctctcgttcaaccacgacctctaccgg
agcgtactcgaccgaccgttctgggtgatggaacagcaaccgggcgacgttaactggccg
ccccactcgacccagcccgcggagggggcgatgcgcctctgggcccaccacgcgaccgcc
cacggcgccgacgccgtcgtctacttccgctggcggcgctgcctcgagggccaggagcag
taccacgccggcctccgcaagcaggacgggtcggcggatcggggctacgacgacgcgacg
cgggccgccgaggaactgttcgacctcgaccacgtcgacgcgcccgtcgccctgcttcac
gactacgagaacgcgtgggcgctcggcgaacagccccacgcgcccgacttcgactactgg
cagctgttgcagtcgttctacgcgtcgctgcgagcgcacggcgtgcaggtcgatatcgtc
catcccgagagcgacctcgagtcctacgacgcggtcgtcgcgccgacgctccacctggcg
accgagtcgctggccgaccacctgaccgcgtacgtcgaatccggcggcgaactgctgctc
ggcccgcggacgggggtcaaagacgcgcacaataagctccgtcccgatctccagcccggt
ccgctgtcggagctcgtcggcgcgagcgtcgaccaacacgagtcgctcccgacgcagttc
gagccgaccgtcgccggaaccgacgggacgaacgccgagtacgcgttccgaacgtgggcc
gagtggctcgaggccgacgcggccgagccgctactcgagtacgcgggcgacgatatcgaa
ggcggacggacggcggccgtccgaaacgcggtcggtgagggaagcgtcgtctactgcggt
gtctggcccgagaccgacctcgcgaacgacctcgtcgggtcgctcctcgaccgcgccggc
gtccgccggatggacgtgctccccgacggcgttcgcgtcgcccgacgcgacggccacacc
tgggtgctgaacttcgggagcgacccgatcgcggtgaccctcgagggggacgcgtcgtgg
cgactcggcggtccggaaatcggtccgttcgatctcgcgatcgccgagaccaacgcggtc
gacgacctctcggtacggatccgagactag

DBGET integrated database retrieval system