KEGG   Haloterrigena turkmenica: Htur_3895Help
Entry
Htur_3895         CDS       T01154                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
htu  Haloterrigena turkmenica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:htu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:htu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:htu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR01:132719..134146
Genome map
AA seq 475 aa AA seqDB search
MHRLEERVPSRSRSSVKIGYVGGGSHGWAHTLINDLLQCDDLAGTVSLYDVDYEAAEQNA
RLANGLAERSDANGAWTFEARREVDDALADADFVICSIQDPVGETFVHDIDVPQEYGIYQ
TVADTVGPGGVLRSLRAIPQYREIAATVREQCPDAWVINYTNPMTVCTRALYEEFPDINA
IGLCHEVFGTQRLLADIAERYVDEAEDVAADEIDVNVKGINHFTWVDEAYWNGHDLFQYL
DRELEERKPIPGFEPGELNDESYWTNHHQIAFDLYDRFGVLGAAGDRHLAEFVPWYLDID
EPEEIQRWGIRLTPSSARTGDSEGPAKMERYLSGDEEFEFTESGEEVVDIMRALEGLEPI
KTHVNHPNRGQTPDLPTGAVVETNAVITGGGVAPITAGELPREVRSMVLTAVHNQETLIE
AGFAGDLDLAFQAFLNEPLVTIQRDEARDLFADLVALERDYLRDYDLENADVLEG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgactcgaggagagagtgccgtcgcggtcgcgttcgtcggtgaagatcggctac
gtcggcggcggcagtcacggctgggcgcacacgctcatcaacgacctgctccagtgcgac
gatctcgcggggacggtatcgctctacgacgtcgactacgaagcggccgagcagaacgcg
aggctggcgaacggcctcgcggagcggtcggacgccaacggggcgtggacgttcgaggcg
cgtcgggaggtcgacgacgcgctcgcggacgccgacttcgtcatctgctcgattcaggat
ccggtcggggagacgttcgtccacgacatcgacgtcccccaggagtacggcatttaccag
accgtcgcggacacggtcggccccggcggcgtcctgcgctcgctgcgagcgatcccgcag
taccgcgagatcgcggcgacggtccgcgaacagtgtcccgacgcgtgggtgatcaactac
acgaacccgatgacggtctgtacgcgggcgctctacgaggagttccccgacatcaacgcg
atcgggctctgccacgaggtgttcggtacccagcggctgctggccgacatcgccgagcgc
tacgtcgacgaggccgaagacgtcgcggccgacgagatcgacgtgaacgtcaaagggatc
aaccacttcacgtgggtcgacgaggcctactggaacggacacgacctcttccagtatctc
gatcgcgaactcgaggagcggaaaccgattccggggttcgaacccggcgaactgaacgac
gagtcctactggacgaaccaccaccagatcgccttcgatctgtacgaccggttcggggtg
ctcggcgcggcgggcgaccgccacctcgccgagttcgtcccctggtatctcgacatcgac
gagcccgaggagatccagcgctgggggatccggctgacccccagttccgcccggaccggc
gacagcgaggggccggcgaagatggaacgatacctgtccggcgacgaggagttcgagttc
accgagtccggcgaggaggtcgtcgatatcatgcgcgcgctcgagggactcgagccgatc
aagacgcacgtcaaccacccgaatcggggccagacgcccgacctgccgacgggcgccgtc
gtcgagaccaacgccgtcatcaccggcggcggcgtcgcgccgatcaccgccggcgaactc
ccccgcgaagtgcggtcgatggtactgacggccgtgcacaaccaggagacgcttatcgag
gccggcttcgccggtgatctggaccttgccttccaggcgttcctcaacgaaccgctggtc
accattcagcgcgacgaggcccgcgacctgttcgccgacctcgtcgccctcgagcgcgac
tacctccgggactacgacctcgagaacgccgacgtcctcgagggctga

DBGET integrated database retrieval system