KEGG   Haloterrigena turkmenica: Htur_3895Help
Entry
Htur_3895         CDS       T01154                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
htu  Haloterrigena turkmenica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Htur_3895
  Lipid metabolism
   00561 Glycerolipid metabolism
    Htur_3895
   00600 Sphingolipid metabolism
    Htur_3895
Enzymes [BR:htu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Htur_3895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR01:132719..134146
Genome map
AA seq 475 aa AA seqDB search
MHRLEERVPSRSRSSVKIGYVGGGSHGWAHTLINDLLQCDDLAGTVSLYDVDYEAAEQNA
RLANGLAERSDANGAWTFEARREVDDALADADFVICSIQDPVGETFVHDIDVPQEYGIYQ
TVADTVGPGGVLRSLRAIPQYREIAATVREQCPDAWVINYTNPMTVCTRALYEEFPDINA
IGLCHEVFGTQRLLADIAERYVDEAEDVAADEIDVNVKGINHFTWVDEAYWNGHDLFQYL
DRELEERKPIPGFEPGELNDESYWTNHHQIAFDLYDRFGVLGAAGDRHLAEFVPWYLDID
EPEEIQRWGIRLTPSSARTGDSEGPAKMERYLSGDEEFEFTESGEEVVDIMRALEGLEPI
KTHVNHPNRGQTPDLPTGAVVETNAVITGGGVAPITAGELPREVRSMVLTAVHNQETLIE
AGFAGDLDLAFQAFLNEPLVTIQRDEARDLFADLVALERDYLRDYDLENADVLEG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgactcgaggagagagtgccgtcgcggtcgcgttcgtcggtgaagatcggctac
gtcggcggcggcagtcacggctgggcgcacacgctcatcaacgacctgctccagtgcgac
gatctcgcggggacggtatcgctctacgacgtcgactacgaagcggccgagcagaacgcg
aggctggcgaacggcctcgcggagcggtcggacgccaacggggcgtggacgttcgaggcg
cgtcgggaggtcgacgacgcgctcgcggacgccgacttcgtcatctgctcgattcaggat
ccggtcggggagacgttcgtccacgacatcgacgtcccccaggagtacggcatttaccag
accgtcgcggacacggtcggccccggcggcgtcctgcgctcgctgcgagcgatcccgcag
taccgcgagatcgcggcgacggtccgcgaacagtgtcccgacgcgtgggtgatcaactac
acgaacccgatgacggtctgtacgcgggcgctctacgaggagttccccgacatcaacgcg
atcgggctctgccacgaggtgttcggtacccagcggctgctggccgacatcgccgagcgc
tacgtcgacgaggccgaagacgtcgcggccgacgagatcgacgtgaacgtcaaagggatc
aaccacttcacgtgggtcgacgaggcctactggaacggacacgacctcttccagtatctc
gatcgcgaactcgaggagcggaaaccgattccggggttcgaacccggcgaactgaacgac
gagtcctactggacgaaccaccaccagatcgccttcgatctgtacgaccggttcggggtg
ctcggcgcggcgggcgaccgccacctcgccgagttcgtcccctggtatctcgacatcgac
gagcccgaggagatccagcgctgggggatccggctgacccccagttccgcccggaccggc
gacagcgaggggccggcgaagatggaacgatacctgtccggcgacgaggagttcgagttc
accgagtccggcgaggaggtcgtcgatatcatgcgcgcgctcgagggactcgagccgatc
aagacgcacgtcaaccacccgaatcggggccagacgcccgacctgccgacgggcgccgtc
gtcgagaccaacgccgtcatcaccggcggcggcgtcgcgccgatcaccgccggcgaactc
ccccgcgaagtgcggtcgatggtactgacggccgtgcacaaccaggagacgcttatcgag
gccggcttcgccggtgatctggaccttgccttccaggcgttcctcaacgaaccgctggtc
accattcagcgcgacgaggcccgcgacctgttcgccgacctcgtcgccctcgagcgcgac
tacctccgggactacgacctcgagaacgccgacgtcctcgagggctga

DBGET integrated database retrieval system