KEGG   Haloterrigena turkmenica: Htur_4343Help
Entry
Htur_4343         CDS       T01154                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00860  Porphyrin and chlorophyll metabolism
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Htur_4343
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Htur_4343
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Htur_4343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_3 Pyr_redox_2 DAO
Motif
Other DBs
NCBI-ProteinID: ADB63157
UniProt: D2S1B0
Position
pHTUR01:606235..607506
Genome map
AA seq 423 aa AA seqDB search
MRIGIVGAGMTGLALTHALAERGVDSVTYEATGEPGGVIDSRVVDGRVIEVGPQRLRLSE
PVAELVDSVGLRRELVAADDSLPLYVYSRGALRRVPRSATAFLKTDLLSPTAKLRVLAEP
LTGDAKPDESIAEVFTRKFGREAYENLAGPIVGGTFGSDPAEMPARHALESLFELEQRHG
NLLVPAAKRLLGSSESPPPVSFERGLQRLPRALADAHDDRVRFETPIRSIREAGDEVVVT
GVDGDVERFDHVVVTTPAGETADLLRETVPEAAALEELTYNPLALVHLVSDAGANGFGYQ
VRRDEPLRTLGVSWNASLFDRDGVYTAFLGGMNDAELCDRADEAIGRIAAREFERVLGAE
ADVLHVETLSSAFPAYDSSWSALDRVDLPERIHLATNYTSRMGIPSRVREANSLAETFAD
EAS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggaatcgtcggagcggggatgacgggactcgcgctcacgcacgcgctcgcc
gagcgcggcgtcgacagtgtcacctacgaagccaccggcgaacccggcggtgtcatcgac
tctcgcgtcgtcgacggacgcgtcatcgaagtcggcccgcagcgcctgcggctcagcgag
ccggtcgcggagttagtcgattcggtcggcttacgacgggagctcgtcgcggccgacgac
tcgctcccgttgtacgtctacagccgcggggcgcttcggcgcgttccgcggtcggcgacc
gcgttcctcaagacggacctcctctcgccgaccgcgaagcttcgcgttctcgcggagccg
ttgaccggggacgcgaagccggacgaatccatcgcggaggtgttcacgcgaaagttcgga
cgggaggcctacgagaacctcgccgggccgatcgtcggcggcacgttcggctccgacccg
gccgagatgcccgcgcggcacgcgctcgagtcgctgttcgaactcgagcagcgacacgga
aacctgctcgtgcccgccgccaaacggctcctcggctcgagcgagtcgcccccgccggtc
tcgttcgagcgcggattgcaacggctcccgcgggcgctcgcggacgcacacgacgaccgg
gtccggttcgaaacgccgatccgatcgatccgcgaggcgggagacgaggtcgtcgtcacg
ggagtcgacggcgacgtcgagcgattcgatcacgtcgtcgtaacgacgcccgcgggcgag
actgccgacctgctccgagagactgttccggaggcggctgctctcgaggaactcacctac
aatccgctcgcgctcgtgcacctcgtctccgacgccggcgcgaacgggttcggctaccag
gttcgacgcgacgaaccgctgcggaccctcggcgtgtcctggaacgcgagcctgttcgac
cgcgacggcgtctacacggccttcctcggggggatgaacgacgcagaactctgcgacagg
gcggacgaagcaatcggccggatcgcggctcgagagttcgagcgcgtcctcggcgccgag
gccgacgtgttgcacgtcgagacgctctcctcggcgtttccggcctatgattcgtcgtgg
agcgcgctcgaccgcgtcgacctccccgagcggatccacctcgcgacgaactacacgtca
cgaatggggattccctcgcgcgttcgggaggcgaacagtctcgcggagacgttcgccgac
gaagccagctag

DBGET integrated database retrieval system