KEGG   Haloterrigena turkmenica: Htur_4675Help
Entry
Htur_4675         CDS       T01154                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
htu  Haloterrigena turkmenica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:htu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:htu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:htu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR02:262032..263657
Genome map
AA seq 541 aa AA seqDB search
MKVAAATGASSLLANSTVTADDNSDRSESADKTLVESPPMGWNSWNTFYCDIDEELIKDA
ADAMAESGMKEAGYEYVCIDDCWMAPERDANGKLQPDPETFPNGISALADYVHDKGLKLG
IYESAGTTTCQGLPGSLGYEETDAQTFADWGVDFLKYDNCGDHYGLSAVERYTRMHNALE
AVDRDIIFSICEWGDNDPWMWAPEVGGDLWRTTGDIKPLWRAQEDLWGNGIIDIIDQNEP
LAEYAGPGRWNDPDMLVVGVDLPEYPNLTEAEDRTHFGMWAMMAAPLMAGNDIRNMSDET
RDILTNDEVIAIDQDPAGNQATRIQHIRGEDGLSRSVWAKTLANGDRAVGLLNRSDRRTT
VTTSAQAVGLEAASCYVARDLWNGTDWQTAGLISASVPSHGLALFRVSSGNPDGTNPFAT
VSLGDTEATVAPGEAVTRSLTFTNYSPMAIDSVHVTCDSPDGWESEPTSTTFTDIAAGPA
ISGASGPQNDAATDWMIRPPRDAPSKDYELSVTAEYADGVSIAEPFTVTVENNTGHDSDP
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggcagcggcgacgggagccagtagtctcctcgcgaactcgacggttaccgcc
gacgacaacagcgaccggagcgagagtgcagacaagacattggtggaatccccaccgatg
ggatggaacagctggaacacgttctactgtgacatcgacgaggaattgatcaaggacgcc
gccgatgcaatggccgaaagcgggatgaaagaagcgggctacgagtacgtctgtatcgac
gattgctggatggcacccgaacgcgacgcgaacgggaaactccaaccagatcccgagacg
tttccgaacggcatcagtgctctcgccgattatgttcacgacaaaggcctcaaactgggt
atctacgaatcagcggggacgacgacgtgtcagggccttcccggcagcctcggttacgaa
gaaaccgatgcacagacgttcgctgactggggagttgacttcctcaaatacgataactgc
ggggaccattacggcctatcggcggttgagcgctatacgcgaatgcacaacgcgctcgaa
gccgttgatcgggatattattttcagcatctgtgaatggggagataacgatccgtggatg
tgggccccagaggtaggcggcgacctctggcggacaactggcgatattaaacccctctgg
agggcccaagaggatctgtgggggaacggcattatcgacatcatcgatcagaatgagccc
ctcgccgaatacgccggtcccggtcgctggaatgatccggacatgctcgtggtcggcgtg
gacctgccggagtatccaaacctaaccgaagcggaagaccgaacgcacttcggcatgtgg
gcgatgatggccgcgccgctcatggctggtaacgacattcgcaatatgtccgacgagact
cgcgatattctcactaacgacgaggtgatcgcgatcgatcaggatccggcgggcaatcag
gcgacgcggattcaacacatcaggggtgaggacggtctctcacgttcagtctgggcgaaa
acactcgcgaatggggatcgagcagtcgggttactgaatcgtagcgataggagaacgaca
gttacgaccagtgctcaggcggtcggacttgaagctgcctcttgctacgttgctcgcgat
ctctggaacggaaccgactggcagaccgccggtcttattagtgcatcggttccgtcacat
gggcttgcattattccgggtcagtagtggtaacccggacggtaccaacccattcgcaacg
gtttcactcggcgatactgaagcgacagtcgcaccgggtgaggcagtcactcgatcgctg
acattcactaattattcgccaatggcaatcgatagcgttcacgtcacctgtgattcgccc
gatggctgggaatccgagcccacctcaacgacgtttaccgatatcgcggccggaccagcg
atttcgggtgcatctggtccgcaaaacgacgccgcaactgactggatgatacgcccccca
agagatgcaccgtccaaagactacgaacttagcgtaaccgcagaatacgcagatggagtc
tctattgcagagccatttaccgtaactgtcgagaataacactggccatgactctgatcct
gactga

DBGET integrated database retrieval system