KEGG   Haloterrigena turkmenica: Htur_4713Help
Entry
Htur_4713         CDS       T01154                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00790  Folate biosynthesis
htu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Htur_4713
Enzymes [BR:htu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Htur_4713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADB63490
UniProt: D2S293
Position
pHTUR02:310097..312529
Genome map
AA seq 810 aa AA seqDB search
MEYHESVDYLESLQRRRPKLGTETTAALLTHLDRPHEDLDCVQIAGSNGKGSTACMLERV
LRDAGLDVGLYTSPDLNDLRERIQINGRKIPKQRVQEFVAEIDDCVERLREVDDTPTYFE
VLTALALHHFANEDVDVAVLEVGIGGRYDATSAVDPVASAVTSVSLEHTDILGDTIEEIA
RDKAQVSPADAPLVTGASGAALEAIRSETDVITVGSDDADVVAREHGLASPIESEISIAG
PKWSFETRLPLVGPHQATNAGVAATLADQVAGVDPESIARGLRDSYWPGRFEVMSTTPLA
ILDGAHNPGACETLASLVDRYSFDDLHLVFGAMREKDHRGMAAALPSPDALYLCEPDVPR
AENTDALAAAFDDRPATIDCAGSVLEATERALSAADEGDCVLVTGSLYAVAEARDRWTRL
QIPKRTAATEQARNVLTSAAVDAETAESVADETVHRTIKTYLRGPQAERVEQAFEAIGGT
CVRSDAETAGRRVVTILSGTSSQFRDLFEELTDADRGLAHVAAQLRRTIDDDRVDERADR
DRYPWDRTPAVMGILNVTPDSFYDGGEYDRVPDAVRQAREMVAAGADIIDVGGESTRPGA
EPVSVAEEIDRVVPVIERIADLDPDVPISVDTRKAAVADAALEAGADIVNDVSGLEDPEM
RFVVADHDASLVIMHSLETPVNPDRTVTYDDVVEDVLHELSETVLLAERAGLDRDQIVVD
PGLGFGKNPAESFELAARIDELRALGCPIMIGHSRKSMFDRVGCEPGERLPPTLAVTTMA
AERGADVVRVHDVSENAAAVRTVRTADARY
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcacgagtcggtcgactacctcgagtcgctacagcggcgtcgacccaagctc
ggaacggaaacgaccgccgcgttactcacgcatctcgatcgcccgcacgaggacctcgac
tgcgtccagatcgccgggtcgaacgggaagggaagcaccgcatgtatgctcgagcgggtt
cttcgcgacgctggactcgatgtcggcctctatacgtcgcctgatctaaacgatctgcgc
gaacggattcagatcaacggccggaaaatcccgaaacagcgggtccaggaattcgtcgcc
gaaatcgacgactgcgtcgaacggctccgcgaggtagacgatacgccgacctacttcgag
gttctcacagcgcttgcgctccaccacttcgccaacgaggacgtcgacgtcgccgttctc
gaggtcggcatcggcggccgatacgacgcgacgagcgccgtcgatcccgtcgcgagcgcc
gtgaccagcgtctcgctggaacacaccgacatcctcggcgacacgatcgaggagatcgcc
cgcgacaaggcacaggtctcgccggccgatgcgccgctggtgaccggcgcgtcgggggcg
gccctcgaggcgatccgctcggagacggacgtgattaccgttggaagcgacgacgcggac
gtggtcgcccgcgagcacgggctggcatcgccgatcgagagcgagatttcgatcgcggga
ccgaagtggtcgttcgagacgcggctgccgctcgtgggcccacatcaggcgaccaacgcc
ggcgtcgcggcgacgctggctgatcaggtcgccggcgtcgatccggaatcgatcgcgcgc
ggtctccgcgactcctactggccgggccggttcgaagtcatgtcgacgacgccgctcgcg
atcctcgacggcgcgcataatccgggcgcctgcgagacgctcgcctcgctcgtcgaccga
tactcgttcgacgacctccacctcgtcttcggcgcgatgcgagagaaggaccaccggggc
atggcggcggcgttgccgtcccccgatgcgctctacctctgtgagccggacgtaccccgc
gccgagaatacggacgccctcgcggccgcgtttgacgatcgcccggcgacgatcgactgc
gcagggtccgtcctcgaggcgaccgagcgggcgctgtcggcggccgacgaaggcgactgc
gtcctcgtcaccggctcgctgtacgcggtcgcagaagcgcgcgaccggtggacgcggctc
cagatcccgaagcgaacggccgcgacggaacaggcgcgaaacgtactcacgagcgcggcc
gtcgacgcggagaccgccgaatccgtcgcggacgagaccgtccatcgaacgatcaagacc
tatctgcgcggtccgcaggccgagcgcgtcgaacaggcgttcgaggcgatcggcggaacg
tgcgtccgttcggacgccgagacggccggtcgccgcgtcgtgacgatcctctccgggacg
tcgtcacagttccgggacctgtttgaggaactgaccgacgccgaccgcggcctcgcccac
gtcgccgcccaactccggcgaacgatcgacgacgatcgcgtcgacgaacgagccgatcgc
gatcggtatccgtgggatcgaacccccgcggtcatgggcatcctgaacgtcacgccggac
agtttctacgacggaggagagtatgaccgcgtgccggacgcggtccggcaagcccgcgaa
atggtcgccgccggcgccgatatcattgacgtcggcggcgagagcacccgtcccggcgcc
gagccggtctcggtcgccgaagagatcgaccgcgtcgtcccggtcatcgaacgcatcgcg
gacctggacccggacgtcccgatctcggttgacacgcggaaagcggccgtcgccgacgcc
gcgctcgaggcgggcgcggacatcgtcaacgacgtctccggactcgaggacccggagatg
cgcttcgtcgtggccgaccacgacgcgtcgctcgtcatcatgcacagcctcgagacgccc
gttaatcccgatcggaccgtcacctacgacgacgtcgtcgaagacgtcctgcacgaactc
tcggagacggtgttgctcgcggaacgtgcgggattggatcgcgaccagatcgtcgtcgat
cccggactcggattcggaaagaatccggccgagagcttcgaactggccgccaggatcgac
gagttgcgcgcgctggggtgtcccatcatgatcggtcactcccggaagtcgatgttcgac
cgcgtcggctgcgagcccggcgagcgattaccgccgacgctcgcggtgacgaccatggca
gccgaacgcggcgccgacgtcgtcagagttcacgacgtctccgaaaacgccgctgcggtt
cggacggtccgcacggcggacgctcgatactag

DBGET integrated database retrieval system