KEGG   Haloterrigena turkmenica: Htur_5260Help
Entry
Htur_5260         CDS       T01154                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
htu  Haloterrigena turkmenica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHTUR04:163395..164369
Genome map
AA seq 324 aa AA seqDB search
MTGGQTAAVTGATGFLGTHLCERLLADGWDVRALSRPSSDRGDLEGTDIDWYVGDLFDVP
TLHELVDGVDVVFHLAGMGLWTAGPETVYRVNADGTENVLAACRDADCGRLVFTSTSGTR
RPDGDAAFADETDVTEPIGAYQESKAVAERLVDDYAADGGDAVTVHPTSIFGPGDEEFTV
QLLSMGLEPTMPAYLPGGLSIVGVSDVVDGLLLAAERGASGDHYILGGENLTYRQAVSRI
AHAADGSPARIQVPATAIHAAGPVAEAASAVADVRMFPFDRQMARLATERLFYTSRKAEA
ELGYEYQPIEAHLPETLEWYRTEA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaggccaaaccgcagccgtcaccggcgcgacgggctttctcggcacgcacctc
tgcgagcggctgctcgccgacggctgggacgttcgtgccctgagccgtccctcgtcggac
cggggcgacctcgagggaaccgatatcgactggtacgtcggggacctcttcgacgtcccg
acgctgcacgaactcgttgacggcgtcgacgtcgtcttccacttggccggaatggggctc
tggaccgccggccccgagacggtctatcgggtcaacgccgacggcaccgagaacgtcctc
gcggcctgccgggacgccgactgcgggcgactcgtcttcacgagcacgtccgggacccgc
cggcccgacggcgacgcggcgttcgccgacgagacggacgtcaccgaaccaatcggcgcc
taccaggagtcgaaggcggtggccgagcggctggtcgacgactacgcggccgacggcggc
gacgccgtcaccgtccacccgacgtcgatcttcggccccggcgacgaggagttcaccgtc
cagttgctctcgatggggctcgagccgacgatgcccgcctacctccccggcggcctgagc
atcgtcggcgtctcggacgtcgtcgacggcctactgctggccgccgagcggggcgccagc
ggcgaccactacatcctcggcggcgagaacctcacctaccggcaggcggtctcgcggatc
gcccacgcggctgacggctctccagcccggatccaggtgcccgcgacggcgatccacgcc
gccggcccggtcgccgaggcggccagcgccgtcgccgacgtgcgcatgttccccttcgac
cgccaaatggcccggctggcgaccgagcggctcttctacacctcgcggaaggccgaggcg
gaactgggctacgagtaccagccgatcgaggcccacctgccggagacactcgagtggtac
cggacggaagcgtag

DBGET integrated database retrieval system