KEGG   Halorhabdus utahensis: Huta_0159Help
Entry
Huta_0159         CDS       T00971                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
hut  Halorhabdus utahensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hut00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hut00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159573..160997
Genome map
AA seq 474 aa AA seqDB search
MCESHEEDGRFEDVSIGFVGGGSRDWAGKMMTDLARQHTLEGEVRLYDVDQESAEQNARL
GELIQDREEAIAEWDYRAVPSLADALSGADVVVLSTQDPPAETFAHDLDIPAEYGIYQSV
GDTVGPGGTFRAMRAIPQYREIAAAIREHCPDAWVLNYTNPMTVCTRTLYEEFPDIKAVG
LCHEVLHVKEDLAAYVEKHRDVADVDGDDLRVNVKGINHFTWIDDVRFRSEGVFDVIDAE
LDSQLPLPGGFEPGDLDGETFYVDNDQIALDLYRRFGLFPAAGDRHLAEFVPWYLNIDDP
QDVQRWGIRLTPSDHRIEHWPTNERQRERHLEGTEEFEFTDTGEKMVELMTALLGGEELV
TNVNLPNRGQLSGVREGAIVETNALVTGDDIVPHAAGDLPEQVRSMVRTHVSNQETLIEA
GFAGDLDLAYRAFLNDPLVTLPPEDARSLFVDLVDAERPYLTDWNLEEATVLEA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagtcccacgaggaagacggccggttcgaggacgtgtcgatcgggttcgtcggc
ggcggttctcgcgactgggcgggcaagatgatgaccgacctcgccagacagcacactctc
gagggcgaggttcgcctctacgacgtcgaccaggagagcgccgaacagaacgcccgcctc
ggcgagctgatccaggatcgcgaggaagcgatcgccgagtgggactaccgggccgtcccg
tccctcgccgacgcgctttcgggcgcggacgtcgttgtcctctcgacgcaggacccgccg
gccgagacgttcgcccacgacctcgacatccccgccgagtacggcatctaccagtccgtc
ggcgacacggtcggcccgggcggaacctttcgggcgatgcgggccatcccccagtatcgc
gagatcgcggccgcgatccgcgaacactgtcccgacgcctgggtgctcaactacaccaac
ccgatgaccgtctgcacccggacgctctatgaggaattccccgatatcaaggccgtcggg
ctctgtcacgaagtgctccacgtcaaggaggacctcgccgcctatgtcgagaagcaccgc
gacgtcgcggacgtcgacggcgacgacctccgggtgaacgtcaagggaatcaaccacttc
acctggatcgacgacgtccgcttccgaagcgagggcgtcttcgacgtgatcgacgccgaa
ctcgattcccagctcccgctccctggcggattcgaacccggcgacctcgacggcgagacc
ttctacgtcgacaacgatcagatcgcgctggatctctatcgacgcttcgggctcttcccc
gccgcgggcgaccgccacctcgccgagttcgtcccgtggtacctgaacatcgacgatccg
caagacgtccagcggtgggggatccgccttacgccgagcgaccaccggatcgagcactgg
ccgacgaacgagcgccagcgcgagcgccatctggaaggcaccgaggagttcgaattcacc
gacaccggcgagaagatggtcgagctcatgacggcactgctcggcggcgaggaactggtc
acgaacgtcaacctccccaaccgggggcaactttccggggttcgcgagggtgcgatcgtc
gagaccaacgcgctggtgacgggcgacgacatcgtcccgcacgccgccggcgacctgccg
gagcaggtccggagcatggtcagaacgcacgtgagcaatcaggagacgctgatcgaggcc
ggattcgctggcgacctcgatctggcgtaccgggcgttcctgaacgatccactcgtgacg
ctgccgcccgaagacgcccgaagcctctttgtcgacctcgtcgacgctgaacgcccctat
ctcaccgactggaacctggaggaggcaactgtcctcgaagcataa

DBGET integrated database retrieval system