KEGG   Halorhabdus utahensis: Huta_0159Help
Entry
Huta_0159         CDS       T00971                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
hut  Halorhabdus utahensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Huta_0159
  Lipid metabolism
   00561 Glycerolipid metabolism
    Huta_0159
   00600 Sphingolipid metabolism
    Huta_0159
Enzymes [BR:hut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Huta_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159573..160997
Genome map
AA seq 474 aa AA seqDB search
MCESHEEDGRFEDVSIGFVGGGSRDWAGKMMTDLARQHTLEGEVRLYDVDQESAEQNARL
GELIQDREEAIAEWDYRAVPSLADALSGADVVVLSTQDPPAETFAHDLDIPAEYGIYQSV
GDTVGPGGTFRAMRAIPQYREIAAAIREHCPDAWVLNYTNPMTVCTRTLYEEFPDIKAVG
LCHEVLHVKEDLAAYVEKHRDVADVDGDDLRVNVKGINHFTWIDDVRFRSEGVFDVIDAE
LDSQLPLPGGFEPGDLDGETFYVDNDQIALDLYRRFGLFPAAGDRHLAEFVPWYLNIDDP
QDVQRWGIRLTPSDHRIEHWPTNERQRERHLEGTEEFEFTDTGEKMVELMTALLGGEELV
TNVNLPNRGQLSGVREGAIVETNALVTGDDIVPHAAGDLPEQVRSMVRTHVSNQETLIEA
GFAGDLDLAYRAFLNDPLVTLPPEDARSLFVDLVDAERPYLTDWNLEEATVLEA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagtcccacgaggaagacggccggttcgaggacgtgtcgatcgggttcgtcggc
ggcggttctcgcgactgggcgggcaagatgatgaccgacctcgccagacagcacactctc
gagggcgaggttcgcctctacgacgtcgaccaggagagcgccgaacagaacgcccgcctc
ggcgagctgatccaggatcgcgaggaagcgatcgccgagtgggactaccgggccgtcccg
tccctcgccgacgcgctttcgggcgcggacgtcgttgtcctctcgacgcaggacccgccg
gccgagacgttcgcccacgacctcgacatccccgccgagtacggcatctaccagtccgtc
ggcgacacggtcggcccgggcggaacctttcgggcgatgcgggccatcccccagtatcgc
gagatcgcggccgcgatccgcgaacactgtcccgacgcctgggtgctcaactacaccaac
ccgatgaccgtctgcacccggacgctctatgaggaattccccgatatcaaggccgtcggg
ctctgtcacgaagtgctccacgtcaaggaggacctcgccgcctatgtcgagaagcaccgc
gacgtcgcggacgtcgacggcgacgacctccgggtgaacgtcaagggaatcaaccacttc
acctggatcgacgacgtccgcttccgaagcgagggcgtcttcgacgtgatcgacgccgaa
ctcgattcccagctcccgctccctggcggattcgaacccggcgacctcgacggcgagacc
ttctacgtcgacaacgatcagatcgcgctggatctctatcgacgcttcgggctcttcccc
gccgcgggcgaccgccacctcgccgagttcgtcccgtggtacctgaacatcgacgatccg
caagacgtccagcggtgggggatccgccttacgccgagcgaccaccggatcgagcactgg
ccgacgaacgagcgccagcgcgagcgccatctggaaggcaccgaggagttcgaattcacc
gacaccggcgagaagatggtcgagctcatgacggcactgctcggcggcgaggaactggtc
acgaacgtcaacctccccaaccgggggcaactttccggggttcgcgagggtgcgatcgtc
gagaccaacgcgctggtgacgggcgacgacatcgtcccgcacgccgccggcgacctgccg
gagcaggtccggagcatggtcagaacgcacgtgagcaatcaggagacgctgatcgaggcc
ggattcgctggcgacctcgatctggcgtaccgggcgttcctgaacgatccactcgtgacg
ctgccgcccgaagacgcccgaagcctctttgtcgacctcgtcgacgctgaacgcccctat
ctcaccgactggaacctggaggaggcaactgtcctcgaagcataa

DBGET integrated database retrieval system