KEGG   Halorhabdus utahensis: Huta_0358Help
Entry
Huta_0358         CDS       T00971                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hut  Halorhabdus utahensis
Pathway
hut00010  Glycolysis / Gluconeogenesis
hut00051  Fructose and mannose metabolism
hut00562  Inositol phosphate metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01120  Microbial metabolism in diverse environments
hut01130  Biosynthesis of antibiotics
hut01200  Carbon metabolism
hut01230  Biosynthesis of amino acids
Module
hut_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_0358
   00051 Fructose and mannose metabolism
    Huta_0358
   00562 Inositol phosphate metabolism
    Huta_0358
Enzymes [BR:hut01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Huta_0358
Exosome [BR:hut04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Huta_0358
  Exosomal proteins of bladder cancer cells
   Huta_0358
  Exosomal proteins of melanoma cells
   Huta_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ACV10545
UniProt: C7NRA8
Position
complement(347868..348515)
Genome map
AA seq 215 aa AA seqDB search
MFVLVNLKTYPCDPVEVAKAAKDVSDESGVRIGVAAQDADIARVADTGVETWAQHVDSIE
YGSNTGHTLAETVADAGAVGTLINHSENRLKLADIDGSVEAAERAGLETCVCANNPAQIG
AVTALGPDSVAVEPPELIGGDVSVATGDPDIVTDAVEAAEAVDEDVEVYCGAGISTGDDV
ESAGELGATGVLLASGVAKADDPRAALEDLVEPLA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgtcaatctcaagacgtacccgtgtgatcccgtcgaagtcgccaaagcc
gccaaggacgtcagcgacgagtcgggcgtccgcatcggcgtcgccgcccaggatgccgac
atcgcgcgcgtcgccgataccggcgtcgaaacgtgggcccagcacgttgactcgatcgag
tatggtagcaataccggccacacgctcgccgaaaccgtcgccgatgccggcgcggtcggc
acgctgatcaaccactccgagaaccgactcaaactcgcagacatcgacggctccgtcgag
gccgcagagcgcgccggcctcgaaacctgcgtgtgtgcgaacaaccccgcacagatcggg
gccgtgaccgcgctcggcccggactcggtcgccgtcgagccgccggaactcatcggcggt
gatgtctccgtcgcgacgggcgaccccgacatcgtaaccgacgccgtcgaggcggccgaa
gctgtcgacgaagatgtcgaagtgtactgtggagccgggatctcgaccggcgacgatgtc
gagtccgcgggcgagcttggcgcgacgggcgtcctcctcgcaagcggtgttgccaaggcc
gacgacccgcgcgcggccctcgaagacctcgtcgaaccgctcgcgtaa

DBGET integrated database retrieval system