KEGG   Halorhabdus utahensis: Huta_0438Help
Entry
Huta_0438         CDS       T00971                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hut  Halorhabdus utahensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_0438
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Huta_0438
   00640 Propanoate metabolism
    Huta_0438
   00660 C5-Branched dibasic acid metabolism
    Huta_0438
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_0438
Enzymes [BR:hut01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Huta_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
431084..432229
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKRVFAEAGIPVPDATLATTVEEAVDAAGEIGFPVAIKAQVHVGGRGKAGGIK
LAEDADEAREAATDILGMDLKGYTVDRVLVEQAVDFVNELYVGVTMDRGAGKPVAMVSTK
GGVNIEEVAAENPDAIAREHVDPAYGLHPYQARKAVYDAGVDREVAGDVASILSTLYDLW
DEKDGSDAEINPVMITDDDEVIAADAVFNVDDDALFRQSEIAQLEGETTDDDLEAMANEY
GFDYVRLSGNVGIIGNGAGLVMTTLDLVDHYGGSPANFLDIGGGAKAGRVRNALEVVFAD
DNVDSVVFNIFGGITRGDEVARGINEALEEFDTIPNPVTVRLAGTNSVQGMEILNTDLVT
VEETLEEAVQRAVADAEEVAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgactccacgagtaccaggcaaagcgcgtattcgccgaggccgggattccggtccca
gatgcaactctcgcgacgaccgtcgaggaagcggtcgacgcggcaggagagatcggcttc
ccggtggcgatcaaagcacaggtacacgtcggcgggcggggcaaggccggcgggatcaaa
cttgccgaggacgccgacgaggctcgggaagcggccacggacatcctcgggatggatctg
aagggctacaccgtcgatcgcgtcttggtcgagcaagcggtcgacttcgtgaacgaactc
tacgtcggcgtgacgatggaccgcggggccggcaagccggtcgcgatggtctcgacgaag
ggcggggtcaacatcgaggaggtcgccgccgagaaccccgacgccatcgcgcgcgaacac
gtcgatccggcctacggcctccacccctaccaggctcgcaaggctgtctacgacgcgggc
gtcgaccgcgaggtggccggtgatgtcgcctcgatcctctcgacgctgtacgacctttgg
gacgagaaggacggcagcgacgccgagatcaaccccgtgatgatcacggacgacgacgag
gtcatcgccgccgacgccgtgttcaacgtcgacgacgacgcgctcttccggcagtccgag
atcgcccaactggaaggcgaaacgaccgacgacgacctcgaggcgatggccaacgagtac
ggcttcgattacgtccggctttcgggcaacgtcggcatcatcggcaacggcgcgggcctg
gtgatgacgacgctcgatctcgtcgatcattacggcggatcgcccgcgaacttcctcgac
atcggcggcggggccaaagctggccgcgtccgcaacgccctggaggtcgtcttcgccgac
gacaacgtcgacagcgtcgtgttcaacatcttcggcgggatcacccgcggcgacgaggtc
gcccgcggtatcaacgaggccctcgaagagttcgacacgattcccaacccggtcaccgtt
cgactcgccggcaccaacagcgttcaaggcatggagatactcaacaccgatctcgtgacc
gtcgaggaaacgctcgaagaagccgtccagcgtgctgtcgccgacgccgaggaggtggca
caatga

DBGET integrated database retrieval system