KEGG   Halorhabdus utahensis: Huta_0438Help
Entry
Huta_0438         CDS       T00971                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hut  Halorhabdus utahensis
Pathway
hut00020  Citrate cycle (TCA cycle)
hut00640  Propanoate metabolism
hut00660  C5-Branched dibasic acid metabolism
hut00720  Carbon fixation pathways in prokaryotes
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01120  Microbial metabolism in diverse environments
hut01130  Biosynthesis of antibiotics
hut01200  Carbon metabolism
Module
hut_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hut_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Huta_0438
   00640 Propanoate metabolism
    Huta_0438
   00660 C5-Branched dibasic acid metabolism
    Huta_0438
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_0438
Enzymes [BR:hut01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Huta_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 Ligase_CoA ATP-grasp GARS_A RimK YbaB_DNA_bd
Motif
Other DBs
NCBI-ProteinID: ACV10625
UniProt: C7NS18
Position
431084..432229
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKRVFAEAGIPVPDATLATTVEEAVDAAGEIGFPVAIKAQVHVGGRGKAGGIK
LAEDADEAREAATDILGMDLKGYTVDRVLVEQAVDFVNELYVGVTMDRGAGKPVAMVSTK
GGVNIEEVAAENPDAIAREHVDPAYGLHPYQARKAVYDAGVDREVAGDVASILSTLYDLW
DEKDGSDAEINPVMITDDDEVIAADAVFNVDDDALFRQSEIAQLEGETTDDDLEAMANEY
GFDYVRLSGNVGIIGNGAGLVMTTLDLVDHYGGSPANFLDIGGGAKAGRVRNALEVVFAD
DNVDSVVFNIFGGITRGDEVARGINEALEEFDTIPNPVTVRLAGTNSVQGMEILNTDLVT
VEETLEEAVQRAVADAEEVAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgactccacgagtaccaggcaaagcgcgtattcgccgaggccgggattccggtccca
gatgcaactctcgcgacgaccgtcgaggaagcggtcgacgcggcaggagagatcggcttc
ccggtggcgatcaaagcacaggtacacgtcggcgggcggggcaaggccggcgggatcaaa
cttgccgaggacgccgacgaggctcgggaagcggccacggacatcctcgggatggatctg
aagggctacaccgtcgatcgcgtcttggtcgagcaagcggtcgacttcgtgaacgaactc
tacgtcggcgtgacgatggaccgcggggccggcaagccggtcgcgatggtctcgacgaag
ggcggggtcaacatcgaggaggtcgccgccgagaaccccgacgccatcgcgcgcgaacac
gtcgatccggcctacggcctccacccctaccaggctcgcaaggctgtctacgacgcgggc
gtcgaccgcgaggtggccggtgatgtcgcctcgatcctctcgacgctgtacgacctttgg
gacgagaaggacggcagcgacgccgagatcaaccccgtgatgatcacggacgacgacgag
gtcatcgccgccgacgccgtgttcaacgtcgacgacgacgcgctcttccggcagtccgag
atcgcccaactggaaggcgaaacgaccgacgacgacctcgaggcgatggccaacgagtac
ggcttcgattacgtccggctttcgggcaacgtcggcatcatcggcaacggcgcgggcctg
gtgatgacgacgctcgatctcgtcgatcattacggcggatcgcccgcgaacttcctcgac
atcggcggcggggccaaagctggccgcgtccgcaacgccctggaggtcgtcttcgccgac
gacaacgtcgacagcgtcgtgttcaacatcttcggcgggatcacccgcggcgacgaggtc
gcccgcggtatcaacgaggccctcgaagagttcgacacgattcccaacccggtcaccgtt
cgactcgccggcaccaacagcgttcaaggcatggagatactcaacaccgatctcgtgacc
gtcgaggaaacgctcgaagaagccgtccagcgtgctgtcgccgacgccgaggaggtggca
caatga

DBGET integrated database retrieval system