KEGG   Halorhabdus utahensis: Huta_0450Help
Entry
Huta_0450         CDS       T00971                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hut  Halorhabdus utahensis
Pathway
hut00340  Histidine metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01230  Biosynthesis of amino acids
Module
hut_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Huta_0450
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Huta_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACV10637
UniProt: C7NS30
Position
complement(443841..445115)
Genome map
AA seq 424 aa AA seqDB search
MDVQSISDLDDRRRRALFERDSGIGEIREDVQDIVATVHQDGDEALRDFSRRFDGVEIDD
FDVTEQAAKAYEAIDDEVREAIETAAANIRAFHERQVPEDWSVEPSEGRELGRKYYPLDS
AGVYAPGGTAAYPSSVLMGVVPAKVADVEHVAVATPPAEEINPVTMAAMHAAGADAVYQI
GGAQAIAALAYGTDSIDPVDVIVGPGNRWVTAAKAEVRGDVRIDMLAGPSEVLTLTDATA
DPEIVAAEVVAQAEHDPNAGVVAVTPDSDHAEAVAAEIDRQAPQRERAEIVREALANDAS
GVFLADSMDAAVAFSEDYAPEHIFVHAANERELLDRITNYGSAFVGEFTPVAAGDYASGT
NHVLPTGGSAAIASGLSVDDFVRPATYQQLSEDGLETLRETITTLAEAEGLEAHAQSVET
RFED
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacagtccatttccgacctcgacgaccgacggcgacgagcgctcttcgagcga
gattccgggatcggcgagatccgcgaggatgtccaggacatcgtcgcaacggtccatcag
gacggcgacgaggcccttcgggacttcagtcgccggttcgacggcgtcgagatcgacgac
ttcgacgtcaccgagcaggccgcgaaggcctacgaggcgatcgacgacgaggtacgcgag
gcgatcgagacagccgccgcaaacatccgcgcgttccacgaacgacaggtccccgaggac
tggtctgtcgagccaagcgaggggcgcgaactcggcaggaagtactacccgctcgattcg
gcaggggtctacgcacccggcggcacggcagcctatccctctagcgtgctgatgggcgtc
gtgccagcgaaggtcgccgacgtcgaacacgtcgccgtggcgaccccgccggccgaggag
atcaatccggtcacgatggcggcgatgcacgccgccggtgcggacgccgtctatcagatc
ggcggcgcacaggccatcgctgcactcgcctacggcaccgactcgatcgaccccgtcgac
gtgatcgtcggcccgggcaaccgctgggtcaccgccgcgaaggccgaagtccgcggcgac
gtccggatcgacatgcttgccggccccagcgaggtgctgacgctgaccgacgcgacggca
gaccccgagatcgtcgccgccgaagtggtcgcacaggccgaacacgatcccaacgccggg
gttgtcgcggtgacgcccgattccgaccacgccgaggctgtcgccgcggagatcgaccgc
caggcaccccagcgcgaacgcgccgagatcgtgcgagaggcacttgcaaacgacgccagc
ggcgtctttctcgccgattcgatggatgcggccgtggcgttcagcgaggactacgcgccc
gagcacatcttcgtccacgcggcgaacgagcgcgagctgctcgaccggatcacgaactac
gggagtgcgttcgtcggcgagttcaccccggttgccgcgggtgactacgccagtggtacc
aaccacgtcctcccgaccggcggatcggcagcgatcgcaagcgggctctcggtcgatgac
ttcgtccgtccggcgacgtatcagcaactctccgaggacgggctcgagacgctccgggag
acgatcaccacactggccgaagccgaaggactcgaggcccacgcacagagcgtcgaaacg
cgctttgaggactga

DBGET integrated database retrieval system