KEGG   Halorhabdus utahensis: Huta_0568Help
Entry
Huta_0568         CDS       T00971                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hut  Halorhabdus utahensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Huta_0568
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Huta_0568
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Huta_0568
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Huta_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573154..574317)
Genome map
AA seq 387 aa AA seqDB search
MSDDSDDSGTFGDYGGRHVPDPLMEPLAQLAAAFEDVALSDDFQDEFRDHLEHFAGRPTP
LYHAERLSEAYGAEIYLKREDLLHGGAHKLNNTLGQALMAKKAGKDRLIAETGAGQHGTA
TAMVGAMLDLDTEIYMGEKDVARQRMNVFRMRLMGAEVNEVTRGGQGLADAVDAALEDFA
QNVEDTHYLVGSVVGPDPFPRMVREFQSVIGEEAREQIRDRIGGLPDAAVACVGGGSNAI
GLFDAFRDDDVAFYGAEGGGEGSDSNRHAAPLADGEDDVLHGMKTRVIDDETEVHSVSAG
LDYPGVGPEHAMFRAVGRCDYRGITDDEALEAFRELSMLEGIIPALETSHGLALAKQIAD
EHDTILVNLSGRGDKDMETAAEHFDLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgactccgacgattcggggacgttcggcgactacggcggtcgccacgtgccc
gatccgctcatggaaccgctcgcacaactcgccgccgcgttcgaggacgtggccctcagc
gacgacttccaggacgagtttcgcgaccacctcgaacacttcgccgggcggccgacgccg
ctgtatcacgccgagcgactctcggaggcatacggcgcggagatctacctcaaacgtgag
gatctgctccacggtggcgcacacaagctgaacaacacgctcgggcaggcgctgatggcg
aagaaggccggcaaggaccggctgatcgccgagaccggtgcgggccagcacggtaccgcg
acggcgatggtcggcgcgatgctggatttagacaccgagatctacatgggtgagaaggac
gtcgcccgccagcggatgaacgtcttccggatgcggctgatgggcgcggaagtgaacgag
gtcacccgcggcgggcaggggctcgccgacgctgtcgacgcggcactggaggacttcgcc
cagaacgtcgaggatactcactatctggtgggttcggtcgtcggtcccgatccgttcccg
cggatggttcgggagttccagtccgtgatcggcgaggaggcacgcgagcagatccgcgac
cgcatcggcgggttgccggacgctgcggtcgcctgcgtcggtggcggctcgaacgcgatc
gggctgttcgacgcgttccgtgacgacgacgtggccttttacggcgcggagggtggcggt
gaaggatccgactcaaaccgacacgccgcgccgctggccgatggtgaagacgacgtcctc
cacgggatgaagacccgcgtcatcgacgatgagacggaggtccattccgtctcggccggg
cttgattatccgggcgtcggtcccgagcacgcgatgttccgggccgtgggtcgatgtgac
taccgcgggatcaccgacgacgaggccctggaggcgtttcgggagttgagcatgctcgaa
gggatcatcccggccctggaaacgagccacgggcttgcgctggcgaaacagatcgccgac
gagcacgacacgatcctcgtgaacctgagcggccggggcgacaaggacatggagaccgcc
gccgagcacttcgatctcggatag

DBGET integrated database retrieval system