KEGG   Halorhabdus utahensis: Huta_0602Help
Entry
Huta_0602         CDS       T00971                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hut  Halorhabdus utahensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hut00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601726..604167
Genome map
AA seq 813 aa AA seqDB search
MHYHEAANFLFDLRRFAPRPGTDATRELLAALDDPHESISAVQIAGSNGKGSTARMLEAV
LREAGLDVGLYTSPHLDDVRERVRVNGRKIPKAALVEFIEEVEPYATDRAAAGDSPTFFE
TLTALAFWEFDRQNVDVAILEVGIGGRYDATSVVDPIASAVTSVTLEHTDLLGDTVDEIA
RDKAAVAPADAPLVTAATGDALAAIHDEVEDVIRIGSPDEDADLTVEHGGRDGIESPITL
SGQGLDVETRLPLLGEHQARNAGVAAALARQVADVTDETLATGLRRAHWPGRFEVLDREP
LVVLDGAHNPGGCERVAETLDTFEYDELHLVVGAMCDKDHHGIADALPAPDHVTATHPDV
DRAEDEQVVAHAFESETAAEVQTRSDVAGALADTLDAAGPDDAVLVSGSLYAVREARTRW
TRPNVPKRVESIADAEDVLEGSHVTEAGTWRMRGKGVHRVLKTRVQPRQAQYLKEELLSL
GGECAVSGLGDQDREHVDAVMMGTLAQFKRLAGKLDGQPYGLSPFADEIRESLEIGVAPD
ERGYPWEDGTAVMGILNVTPDSFHDGGEHNAADEAVERAEEMIDAGVDIVDVGGESTRPG
ADPVPAEKERDRVVPVIERLASEDMTISIDTRKVPVAEAALEAGADILNDVTGLDDPAMA
HLAAEHDVPIVVMHSIDTPVDPDHDVHYDDVVEDVIEELTERVLLAEKAGLDRSQILVDP
GLGFGKTDAENFEVLDRLGEFEALGCPLLVGHSHKSMFEMIDRGPDERYEPTVAATALAA
ERGADVIRVHDVAANVAAVDVVEAADDPGSFDG
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcactatcacgaggccgcaaactttctcttcgatctgcggcggtttgcccccagaccg
gggactgacgccactcgcgagttacttgcggcactggacgatccacacgagtcgatctcg
gccgtccagatcgcagggtcgaacggcaaaggctcgaccgcacggatgctcgaagccgtc
ctcagagaggcgggcctcgacgtggggctgtacacctcgccgcatctcgacgacgttcgc
gagcgcgtccgggtgaatggccggaagattccgaaagcggcgctcgtcgaattcatcgag
gaagtcgagccctacgccaccgaccgggccgccgccggcgactcgccgacgttcttcgag
acgctgaccgcgctggcgttctgggagttcgaccgccagaacgtcgacgtcgccatcctc
gaagtggggatcgggggacgctacgacgccacgagcgtcgtcgacccgatcgcgagcgcc
gtcacgagcgtgacgctcgaacacaccgacctcctgggcgataccgtcgacgagatcgcc
cgggacaaggctgccgtcgcccccgcggacgcgccgctcgtgaccgccgcgaccggcgac
gcgctggcagccatccacgacgaagtcgaggacgtcattcgtatagggagcccggacgag
gacgccgacctgacggtcgagcacgggggacgcgacgggatcgagagtccgatcacgctg
tccggacaggggttggacgtcgagacgcgactcccactgctgggcgagcatcaggcacgc
aacgccggtgtcgcggccgccctcgcacgacaggtcgccgatgtgactgacgaaacactt
gctaccggcctgcgtcgcgcccactggccgggccggttcgaggtgctggatcgcgagccg
ctggtcgtcctcgacggcgctcacaatcccggcggctgcgaacgcgtcgccgagacgctc
gacaccttcgagtacgacgagttgcacctggtcgtcggcgcgatgtgtgacaaggaccac
cacggcatcgcggacgcgctgccggcccccgatcacgtcaccgccacccacccagacgtc
gaccgcgccgaggacgagcaggtagtcgcccacgctttcgagtccgagacggctgcggag
gtccagacgcgctcggacgtcgcgggcgcgctcgcagatacgctcgacgcagccgggccg
gacgacgccgtgctcgtctcgggatcgctctatgccgtccgggaggcccgaacgcgctgg
acacggccgaacgtccccaagcgcgtcgaatccatcgcggacgccgaggatgtcctcgag
ggatcccacgtcaccgaggccggcacctggcggatgcgcggcaagggcgtccaccgcgtg
ctcaagacccgcgtccagccacggcaggcccagtatctcaaggaggaactgctctcactc
ggcggggagtgtgccgtttccggcctcggggaccaggatcgcgagcacgtcgacgccgtc
atgatgggcacgctcgcgcagttcaagcgcctcgccgggaaactcgacggccagccctac
ggcctctcgccctttgccgacgagatcagagaatccctcgagatcggcgtcgccccggac
gagcgtggatacccctgggaggacggcaccgcggtcatgggcatcctgaacgtcacgccc
gacagcttccacgacggcggcgagcacaacgccgccgacgaggcggtcgagcgcgccgag
gagatgatcgatgcgggcgtcgacatcgtcgacgtcggcggtgagagcacccgccccggg
gccgatccggtccccgccgagaaggaacgcgatcgggtcgttccagtgatcgagcggctc
gcaagcgaggacatgactatctcgatcgacacgcggaaggttcccgtcgccgaggccgcc
ctggaagccggcgcggacatcctcaacgacgtcaccggcctcgacgacccggcgatggct
cacctcgccgccgaacacgacgtccccatcgtcgtcatgcactcgatcgacacgccggtc
gatccagaccacgacgtccactacgacgacgtcgtcgaggacgtcatcgaggaattgacc
gagcgcgtcctgctggccgagaaggccggcctggatcgctcacagatcctcgtcgacccc
ggcctgggcttcgggaaaaccgacgccgagaacttcgaggttctggatcgcctgggggag
ttcgaggcgctcggctgtccgttgctggtcggccactcgcacaagtcgatgttcgagatg
atcgatcgaggcccggatgagcgttacgagcccacggtggcggcgacggcactcgccgcg
gagcgcggtgcggacgtgatccgggtgcacgacgtggcggcgaacgtcgcagcggtcgac
gtcgttgaggcggccgacgatccgggttcgtttgacggctag

DBGET integrated database retrieval system