KEGG   Halorhabdus utahensis: Huta_0732Help
Entry
Huta_0732         CDS       T00971                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hut  Halorhabdus utahensis
Pathway
hut00250  Alanine, aspartate and glutamate metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Huta_0732
Enzymes [BR:hut01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Huta_0732
Peptidases [BR:hut01002]
 Cysteine Peptidases
  Family C44
   Huta_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase
Motif
Other DBs
NCBI-ProteinID: ACV10917
UniProt: C7NTS8
Position
complement(720826..721935)
Genome map
AA seq 369 aa AA seqDB search
MVSVPSDPSPSRLQGADPDVVRAAIEAGDPLPGTRGFAGRLDGRLVRDVLGRYPLFVERD
NPDSWSFEPGKLADPVPVPAGTVQDGETVTQWWSLPQPSPRSGRRAVDAVRSALDTALDA
VETDGLAVAFSGGVDSALLAARLDVPLYVAGFPESHDVRAAREAAALLDADLRVVELDHA
LLERTVPDVVAATGRTNAMDVEIAVPLYLVASRAATDGFDRLAVGQGADELFGGYAKVAN
APEHSRVGADTVRGAHREGLETLPDQLERDILAIRAAGVEPVAPLLDDHVVEAALSLPGR
LLVSPRGDRKYAFRLATRAWLPDRIAFREKKALQYGSLVARELDRLARQAGFKRRMDNHV
TQYVESLKG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgtcccctccgatccgtcaccatcgaggctccagggtgccgatccggacgtt
gtccgcgcggcgatcgaggcaggcgatcccttgcccggcacccgtgggtttgctggccga
ctcgacgggcgactcgtccgggacgtcctcgggcgctacccgctgttcgtcgaacgcgat
aatccggacagctggtcgttcgaacccggcaaactggccgacccggttcccgttcctgcc
ggcaccgtccaggacggcgagaccgtcacgcaatggtggtcgctgccacagccatcgccc
cggagtggccgacgggcggtcgacgccgtccgctcggctctggacaccgctcttgatgcc
gtcgagacggacgggctcgccgtcgccttctcggggggcgtcgactcggcactcctcgcg
gccagactcgatgtcccgctatacgttgctgggtttcccgagagtcacgacgtccgggcg
gctcgggaagccgccgcactgctcgacgccgacctccgcgtcgtggaactcgatcacgca
ctcctggaacggacggttccggacgtcgtcgcggccacggggcggacgaacgccatggac
gtcgagatcgccgtaccgctgtatctcgtcgcatctcgggcggcgactgacgggttcgac
cgtctggccgttggccagggagccgacgaactgttcggcgggtacgccaaggtcgccaac
gcgccggagcactctcgcgtcggggccgacacggttcggggtgcgcatcgcgagggactc
gaaacgctcccggaccagttagaacgcgatatcctggcgattcgtgcggctggtgtcgaa
cctgtcgcgccgttgctcgacgatcacgtcgtcgaggccgcgctttctctccctggccgc
ttgctggtttctcctcggggagatcggaagtacgcgtttcgacttgccactcgagcgtgg
ctgcccgatcggatcgcctttcgcgaaaagaaggcactccagtatggcagcctcgtcgcg
cgcgagctcgaccgcctggcccgccaggccgggttcaaacgccgcatggacaaccacgtc
actcagtacgtggaatcgctgaaaggataa

DBGET integrated database retrieval system