KEGG   Halorhabdus utahensis: Huta_0857Help
Entry
Huta_0857         CDS       T00971                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hut01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hut01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hut00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hut00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hut00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824197..824883
Genome map
AA seq 228 aa AA seqDB search
MNLPYPHFQINYKVYPGTWGADGLALAEKVEQVSDETGANFVLTPQVPDIRLVARETDLP
VTAPAVDPVEPGRGMGKLLPEALAEAGAVGAVINHAENRDTLADIERKIDRCQAVGLDAI
VCVDSVAMGRAVAAFEPDQLLFERPGDISTDRAISRSHPDRIEAFLAMRDEVAPDTKVRV
GGGISTAEAVDRAFELGVDATGAASAIATADDPANQLRKIGEVVAALS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcccgtatccacacttccagatcaactacaaagtgtacccggggacgtggggg
gctgacggcctggcgctggccgagaaagtcgaacaggtgagcgacgagaccggcgcaaat
ttcgtcctgacgccacaggtgcctgatattcggctggtcgccagggaaaccgacctaccc
gtcaccgcgccggccgtcgatcccgtcgagccgggtcgcggcatgggaaagctcctcccc
gaggcactcgcggaagctggcgcggtcggtgcggtcatcaaccacgccgagaaccgcgat
accctcgccgacatcgaacggaagatcgaccggtgccaggccgtcgggctggacgcgatt
gtctgcgtcgacagcgtggcgatgggacgagccgtcgcggcattcgaaccggaccagctg
ctctttgagcgccccggcgacatctcgaccgaccgggcgatctctcgaagtcatcccgac
cgcatcgaggcgtttctcgccatgcgtgacgaggtggctccggacacgaaggtccgcgtc
ggcggtggaatctcgaccgccgaagctgtcgatcgggccttcgaactcggggtggacgcg
accggtgcggcctcggcgatcgcgaccgctgatgatcccgcgaatcaactccgaaagatc
ggcgaggtcgtcgccgcactcagctga

DBGET integrated database retrieval system