KEGG   Halorhabdus utahensis: Huta_0863Help
Entry
Huta_0863         CDS       T00971                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
hut  Halorhabdus utahensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Huta_0863
  Lipid metabolism
   00561 Glycerolipid metabolism
    Huta_0863
   00600 Sphingolipid metabolism
    Huta_0863
Enzymes [BR:hut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Huta_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829893..831350
Genome map
AA seq 485 aa AA seqDB search
MTESSYGVQAEGIDTDDVTIAYIGGGSREWAPKFFRDLAISDLSGEVRLHDIDHESAERN
AEFGNWVQDRDEVEAEWEYEAVADRDEALDGADAVVLSTQYNPAETFVHDLDIPKEHGIY
GAVAATIGPGGIFRAMRTIPVYREFAASIREQCPDAWVFNFTNPVHFVTRALYDEYPDIN
AVGFCHEVLWTRHHLAKIVEEELGEEAARSDISVNVKGINHFTWIDEARYKGRDLWPLLE
DLVDTDRANREFTPEDLEDDSPFTDKQQVTWELFRRFGVFPAAGDRHLVEYATSFLVGGK
EGLNRWGVKRTTSDYRAKHWNPAESEQTTDVEAWMNGEREFELFHSNEIFDDMMMALAGE
DTMVANVNMPNEGQVTDIEDGAVVETNAVIREGEIKPTTAGGFPRPVRSMINGHVDTIES
IIEASRTGDIDEAFAGFLLDQQVRTLQTEEAREMFAELVAAEEEYLQGWDLDGSDVLAEA
DAYDA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcatcatacggcgtacaagccgagggtatcgacaccgacgacgtgacgatc
gcctacatcggcggcgggagccgcgagtgggcaccgaagttcttccgggaccttgcgatc
tctgacctctcgggagaagtgcggctacacgacatcgaccacgagagcgccgagcgcaac
gccgagttcggcaactgggtccaggaccgcgatgaagtcgaagccgaatgggagtacgaa
gccgtcgcggatcgcgacgaagcgctcgacggcgctgacgctgtcgtcctttcgacgcag
tacaaccccgcggagaccttcgtccacgatctggacatccccaaggagcacggtatctac
ggcgcggtcgccgccaccatcggcccgggcgggatcttccgggcgatgcggacgatcccc
gtctaccgggagttcgccgcctccatccgcgagcagtgtcccgacgcctgggtgttcaac
ttcaccaaccccgtccacttcgtcacccgcgcgctgtacgacgagtatcccgacatcaac
gctgtcggcttctgtcacgaggtgctgtggacgcgccatcatctggcgaagatcgtcgag
gaagaactcggcgaggaggccgcgcggtcggacatctcggtcaacgtcaagggcatcaac
cacttcacgtggatcgacgaagcccggtacaagggccgggacctctggcccctgctcgaa
gacctggtcgacaccgaccgcgcgaaccgcgagttcacgcccgaggacctcgaagacgat
tcgccgttcaccgacaaacagcaggtcacctgggagctgttccgccgcttcggcgtcttc
ccggcggcgggcgaccgccacctcgtcgagtacgcgacctccttcctcgtcggcggcaag
gaggggctcaaccgctggggcgtcaaacggaccaccagcgactatcgcgcgaaacactgg
aaccccgccgagtccgaacagaccaccgacgtcgaggcctggatgaacggcgagcgggag
ttcgaactcttccattcgaacgaaatcttcgacgacatgatgatggcgctggccggggaa
gacacgatggtcgcgaacgtcaacatgcccaacgaggggcaggtcactgacatcgaagac
ggtgccgtcgtcgaaaccaacgccgtgatccgagagggcgagatcaagccgaccaccgcc
ggtgggttcccccgtccggtccggtcgatgatcaacggccacgtcgacaccatcgaatcg
atcatcgaggcctctcgcaccggcgacatcgacgaagccttcgccggcttcctgctcgac
cagcaggtccggacgctccagaccgaggaggcccgcgagatgttcgccgagctggtcgct
gccgaggaagagtatctccagggctgggatctcgacggctcggacgtgctggcggaagcc
gacgcctacgacgcctaa

DBGET integrated database retrieval system