KEGG   Halorhabdus utahensis: Huta_0928Help
Entry
Huta_0928         CDS       T00971                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hut  Halorhabdus utahensis
Pathway
hut00860  Porphyrin and chlorophyll metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01120  Microbial metabolism in diverse environments
Module
hut_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Huta_0928
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Huta_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF1442 Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: ACV11111
UniProt: C7NUU8
Position
893444..894178
Genome map
AA seq 244 aa AA seqDB search
MTDDRPTVAVFRPDDERLETAVELLESLDANPIADPMLAVEPTETLPRTDAEVVVFTSKT
GAELVAGEWTPGDATVCAIGEPTAAALRANGIAVDVVPETYSSSGLVDALGEQVDGLRVE
VARSDHGSDVLLDGLESAGAYVHETVLYRLVRPANAGESVRRAAEGDLDAALFTSSLTVE
HFLAIASERGQRAAAIEGLSEAVVGTIGGPTRETAAGQGVDVDVVPEAAEFEALATAVID
RLDR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaccggccgaccgtcgccgtcttccgcccggacgacgagcgactggagacg
gcggtcgaactcctcgaatcgctcgacgcgaacccaatcgccgacccgatgctcgccgtt
gagccgacggagacgcttccccgcacggacgccgaggtggtcgttttcacgagcaagacc
ggggccgaactggtggccggcgagtggacgcccggcgacgcaacagtgtgtgcgatcggc
gagccgacggccgccgcactccgggcgaacgggatcgcggtcgacgtcgtgccggagacg
tactcctcgtccggactcgtcgatgcactcggggagcaagtcgacgggctgcgagtcgag
gtcgcccgcagcgaccacggcagcgacgtgttgctggacgggctggaatcggccggcgcg
tacgtccacgagacggtactgtatcgactcgtccgtccagcgaacgccggcgagtccgtc
cggcgggccgccgaaggcgacctcgacgccgcgctgttcacctcctcgttgacggtcgaa
cactttctggcgatcgcgagtgagcgaggccagcgagcggcggcgatcgagggattgtcc
gaggcagtcgtggggacgatcggcggaccaacccgagagacggcagcgggacagggagtc
gacgtcgatgtcgttcccgaagcggccgagttcgaggcacttgccacagcggtcatcgat
cggctcgatcgatag

DBGET integrated database retrieval system