KEGG   Halorhabdus utahensis: Huta_0928Help
Entry
Huta_0928         CDS       T00971                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hut  Halorhabdus utahensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hut00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893444..894178
Genome map
AA seq 244 aa AA seqDB search
MTDDRPTVAVFRPDDERLETAVELLESLDANPIADPMLAVEPTETLPRTDAEVVVFTSKT
GAELVAGEWTPGDATVCAIGEPTAAALRANGIAVDVVPETYSSSGLVDALGEQVDGLRVE
VARSDHGSDVLLDGLESAGAYVHETVLYRLVRPANAGESVRRAAEGDLDAALFTSSLTVE
HFLAIASERGQRAAAIEGLSEAVVGTIGGPTRETAAGQGVDVDVVPEAAEFEALATAVID
RLDR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaccggccgaccgtcgccgtcttccgcccggacgacgagcgactggagacg
gcggtcgaactcctcgaatcgctcgacgcgaacccaatcgccgacccgatgctcgccgtt
gagccgacggagacgcttccccgcacggacgccgaggtggtcgttttcacgagcaagacc
ggggccgaactggtggccggcgagtggacgcccggcgacgcaacagtgtgtgcgatcggc
gagccgacggccgccgcactccgggcgaacgggatcgcggtcgacgtcgtgccggagacg
tactcctcgtccggactcgtcgatgcactcggggagcaagtcgacgggctgcgagtcgag
gtcgcccgcagcgaccacggcagcgacgtgttgctggacgggctggaatcggccggcgcg
tacgtccacgagacggtactgtatcgactcgtccgtccagcgaacgccggcgagtccgtc
cggcgggccgccgaaggcgacctcgacgccgcgctgttcacctcctcgttgacggtcgaa
cactttctggcgatcgcgagtgagcgaggccagcgagcggcggcgatcgagggattgtcc
gaggcagtcgtggggacgatcggcggaccaacccgagagacggcagcgggacagggagtc
gacgtcgatgtcgttcccgaagcggccgagttcgaggcacttgccacagcggtcatcgat
cggctcgatcgatag

DBGET integrated database retrieval system