KEGG   Halorhabdus utahensis: Huta_1170Help
Entry
Huta_1170         CDS       T00971                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hut  Halorhabdus utahensis
Pathway
hut00260  Glycine, serine and threonine metabolism
hut00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01130  Biosynthesis of antibiotics
hut01230  Biosynthesis of amino acids
Module
hut_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Huta_1170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Huta_1170
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Huta_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV11346
UniProt: C7NMN3
Position
1145271..1146521
Genome map
AA seq 416 aa AA seqDB search
MTTDDTNGRFGGYGGQYVPEALMPAIEELRDAYERYVLHNEDGFMDELRAHLADFGGRPT
PLQRADQLSERYDTEVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGT
ATAMAAAHLDMPAEIFMGETDIERQRPNVFRMELNGATVTPVTTGRGTLKEAISETMRDW
ATNVEDTHYVIGSIVGPDPFPEMVRDFQSVIGDETHEQILAKTGDTPDSIVACAGGGSNT
MGAFHEFRDKEDVDLIAVEAGGSSLEVDEEAGVAPNSATLSTGEEGVLHGARTKLLQDED
GQIMESHSVSAGLDYSGVGPELAYLVDTGRVEAVNVDDKTALESFHRVSRLEGIIPALET
AHAFGYLEENPDAVGDVTVVNVSGRGDKDLESVVEETKERDLDVETASSVLQEAKE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagacgatacgaacggcagattcggcggctacgggggccagtacgtccccgaa
gcgcttatgcccgccatcgaggagcttcgggacgcctacgaacgctacgtgctacacaac
gaggacgggttcatggacgaactccgcgcccacctcgcggacttcggcggtcggcccacc
ccgctgcagcgggccgaccagttgagcgagcgctacgacaccgaggtctatctcaagcgc
gaggacttgctccatggcggcgcgcacaaactcaacaacgccctcgggcaggtcctgctg
gcgaagtacatgggcaaggaacggatcatcgccgagacgggggccggccagcacggcacg
gcgaccgcgatggccgccgcccacctcgatatgcctgctgagatcttcatgggcgaaacc
gacatcgaacgccagcgccccaacgtcttccggatggaactcaacggcgcgacggtcacg
ccagtgacgaccggccgggggaccctgaaggaagccatcagcgagacgatgcgcgactgg
gcgaccaacgtcgaggacacccactacgtcatcgggtcaatcgtcggcccggacccgttc
cccgaaatggtccgggacttccagtcggtcatcggtgacgagacccacgagcagatcctc
gcgaagaccggcgacacccccgattcgatcgtcgcgtgtgcgggcggcgggtcgaacacg
atgggtgccttccacgaattcagagacaaggaggacgtcgacctgatcgccgtcgaggcc
ggcgggtcctcgctggaagtcgacgaagaagctggcgtcgcacccaactccgccaccctg
tcgaccggtgaggagggcgtcctccacggtgctcgcacgaaactcctccaggacgaggac
ggccagatcatggagtcccacagcgtctcggcggggctggactactcgggcgtcggcccg
gagctcgcctatctcgttgatacgggccgcgtcgaggcggtcaacgtcgacgacaagacg
gcactcgaatcgttccatcgcgtctcgcggctcgaaggcatcattcccgccctggagacc
gcccacgccttcgggtaccttgaggagaatcccgacgccgtcggcgacgtcaccgtcgtc
aacgtctcgggccggggcgacaaggatctggagagtgttgtcgaggagaccaaagagcgc
gatctcgacgtcgaaacggcctcaagtgtccttcaggaggcgaaggaatga

DBGET integrated database retrieval system