KEGG   Halorhabdus utahensis: Huta_1171Help
Entry
Huta_1171         CDS       T00971                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hut  Halorhabdus utahensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Huta_1171 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Huta_1171 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Huta_1171 (trpA)
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Huta_1171 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146518..1147357
Genome map
AA seq 279 aa AA seqDB search
MTANSEIGAVFESGEPAFIPYLVAGDPEYEASLEYVEALERGGADIVELGLPFSEPIAEG
PTIQNAIVRSMEGGMTPDRFFAFVEELDVGIPLVCMTYYNLIFQYGSEAGPRPFVKRAAE
AGIAGLVVPDLPAEEADPLRDACDEYGLDLVFIVAPTTRGDRLKTIMDQVSGYVYVQARL
GTTGARDDVSDQTDESLARLREWDVPKAVGFGIKTGEHAERIVSAGADGIIVGSALVDIV
ADGADSGESTEAVADRLEAKARELKDGALRGTPSAAVED
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaacagcgagatcggggccgtcttcgaatcgggcgaacccgcgttcatcccg
tatctggtggccggtgatccggagtacgaggcctccctggaatacgtcgaggccctggaa
cgcggcggagccgatatcgtcgaactcgggttgcccttctccgaaccgatcgccgaaggg
ccgacgatccagaacgcgatcgtcaggtcgatggagggtgggatgacacccgatcgcttc
tttgcgttcgtcgaagagctggacgtcgggattccgctggtctgtatgacctattataac
ctcatttttcaatatggatccgaagcgggtccccggccgttcgtcaagcgcgccgccgag
gccggcatcgcggggcttgtcgtgccggatcttccagccgaggaagccgacccgttgcgg
gatgcctgcgacgaatacgggctggatctggtcttcatcgtcgcgccgacgacccgtggc
gaccgtctgaagaccatcatggaccaggtctcggggtacgtctacgtccaggcgcgcctc
gggacgacgggcgcacgcgatgacgtcagcgatcagaccgacgagagtctcgcgcgcctc
cgggagtgggacgtcccgaaggccgtcggcttcgggatcaagaccggcgagcacgccgag
cgaatcgtctcggccggtgctgacgggatcatcgtcgggagcgccctggtcgacatcgtc
gcggacggtgcagacagtggcgaatcgaccgaagcggttgctgatcggctcgaagcgaag
gcccgggaactcaaagacggcgcgttgcggggcacgccatcggcggcagtcgaagactga

DBGET integrated database retrieval system