KEGG   Halorhabdus utahensis: Huta_1259Help
Entry
Huta_1259         CDS       T00971                                 

Definition
(RefSeq) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Huta_1259
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Huta_1259
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Huta_1259
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Huta_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1230758..1231828
Genome map
AA seq 356 aa AA seqDB search
MERVCTDCGRTYPLEGPWRCACGSPLDLGGLPDLPAQPPEIDRDSGLWACEGFLPVEPLV
TLGEGWTPLIDAEATGLQYKLEHLFPTGSFKDRGAAVVLSHALDRGADRVIEDSSGNAGL
AIATYAARAGIDAEIFVPVDAKPGKLRAIERTGAALRRIDGDREAVTQACIDAVEAGDGY
YASHAWEPMFLAGTATFALEVAAQRGWEAPDAVVTPLGHGTLFLGASRGFDRLQRAGWID
DVPRLFGIQASGVAPITAARGNDRDAERNNLADGIQIAEPVRGDGILDAIEASGGDAVAV
TAAETEAGHERLLGEGLDLDPTSATALAGLERLREQGVIAADSDVVVPLTGRNRSV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtctgtactgactgcggacggacgtacccactcgagggcccctggcgatgt
gcatgcgggagtccgctcgacctgggggggctccccgatctgcccgcacagccgcccgag
atcgaccgcgacagcggtctgtgggcctgcgaaggcttcctgcccgtcgagccactggta
acgctcggcgaagggtggaccccgctgatcgacgccgaggcaactggcctccagtacaag
ctcgaacacctgtttccgacggggagcttcaaggatcgcggcgcggcggtcgtgctctcc
cacgccctcgatcggggggccgaccgggtgatcgaagattcctcgggcaacgcggggctg
gcgatcgcgacatacgcggcccgtgccggcatcgacgccgagatcttcgtccccgtcgat
gccaaaccggggaaacttcgggcgatcgaacggacgggagccgccctgcggcggatcgac
ggtgaccgggaagctgtgacccaggcctgcattgatgcggtcgaggccggcgacggctac
tacgccagccacgcttgggaaccgatgtttctggccggaacggcgacgttcgcgctcgaa
gtcgcggcccagcgcggctgggaagcccccgacgccgtggtgacgccactgggtcacgga
acgctgtttctgggcgcgtctcgcgggtttgatcgcctgcagcgtgccggctggatcgac
gacgtgccgcgactcttcggcatccaggcgagcggcgtcgccccgatcaccgcggcgcga
gggaacgaccgcgacgccgaacggaacaacctggccgacggcatccagatcgccgagccg
gtccgaggggacggaatcctcgacgcgatcgaagcgagtggcggcgacgcggtcgcggtc
acggctgccgagacagaagccggccatgagcgcctgctcggagagggtcttgaccttgac
cctacgagtgcgactgcgctcgccggcctcgaacgccttcgcgagcagggtgtcatcgcc
gccgatagcgacgttgtcgtcccattgacgggccgaaaccgatcggtgtga

DBGET integrated database retrieval system