KEGG   Halorhabdus utahensis: Huta_1362Help
Entry
Huta_1362         CDS       T00971                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hut  Halorhabdus utahensis
Pathway
hut00860  Porphyrin and chlorophyll metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01120  Microbial metabolism in diverse environments
Module
hut_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Huta_1362
Enzymes [BR:hut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Huta_1362
Exosome [BR:hut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Huta_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACV11538
UniProt: C7NND8
Position
complement(1332917..1333897)
Genome map
AA seq 326 aa AA seqDB search
MNHPNRPRRLRTDGIRPLVSETTLDASDLIAPVFIDATTDERVPIETMPGHERVPVEQAV
ERVQEIRETGVEAIIVFGVPESKDSEGSRAWADDGVVQKAVRRITAETDAYVITDVCMCE
YADHGHCGLLEDDARQDPVLTVRNDETLDALARTAVSHAAAGADMVAPSAMMDGMVGAIR
EGLDDAGHTEVPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREAMREVTL
DVEEGADVLMVKPALPYLDIVRDVRERFDQPVAAYNVSGEYAMLHAASEQGWLDLEATAY
ESLLSIKRAGADLILTYFAEDVAGAL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcccaaccgcccgcgccgtctccggacggatggcatcaggccacttgtcagc
gaaaccacgctggatgcgagcgatctgattgcgcccgtcttcatcgacgcgacgactgac
gaacgggtacccatcgagacgatgcccggtcacgagcgcgtcccggtcgagcaggcggtc
gagcgtgttcaggagatccgtgagaccggcgtcgaagcgatcatcgtcttcggggtgcca
gaatcgaaagacagcgagggatcgcgggcctgggccgacgatggcgtcgtccagaaggct
gtccggcggatcactgccgagaccgacgcctacgtcatcactgacgtctgcatgtgcgag
tacgccgaccacggccactgcggtctcctcgaagacgacgcccgccaggacccggtgttg
actgtccgcaacgacgagacactggacgcgctggcccggacagccgtctcccacgcggcg
gcgggcgcggacatggttgcgccctccgcgatgatggacggcatggtcggggcgatccgc
gagggcctcgacgacgccggtcacaccgaggtgccgatcatgagttacgccgccaagtac
gagtcggcgttttacggcccgttccgggacgcagccgacggcgcgcccgccttcggtgat
cgccgccactaccagatggatcccgccaacgcccgcgaggccatgcgtgaggtgactctc
gacgtcgaagagggggcggacgtcctgatggtcaagccagcattgccgtatctcgacatc
gtccgtgacgtgcgcgagcgcttcgaccagcccgtcgccgcgtacaacgtcagcggcgag
tacgcgatgttgcacgccgcaagcgaacagggctggctcgatctggaggcgaccgcttac
gagtcgctcctctcgatcaagcgtgcgggtgccgatctcattctgacgtacttcgccgag
gacgtcgccggcgcgctgtag

DBGET integrated database retrieval system