KEGG   Halorhabdus utahensis: Huta_1396Help
Entry
Huta_1396         CDS       T00971                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hut  Halorhabdus utahensis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:hut00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366884..1367639)
Genome map
AA seq 251 aa AA seqDB search
MEVFAVPDIPEIEPGDDLAALIDERVDLREGDVLTVASTVVSKAEGRGADLSDFEPGARA
HDIAERISEIAGERKDPRFAQAVLEESEELVMEAPFILAVTHFGHITVNAGIDRSNVPGA
DLLLLPEDPSASAQRLSDALGVPVVVTDTSGRPFRQGQRGVALGWAGISAMRDWRGEHDR
EGRELTATVEAVVDELAAATNLVTGEGDDGRPVAVVRDWDFGDHDSHDDLFRDRDGDLVR
QALADFEYDPA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcttcgcggtcccggatattccggaaatcgagccgggtgacgacctggcggcg
ctgatcgacgagcgcgtcgacctacgggagggcgatgtcctcacggtcgccagtacagtc
gtctcgaaggccgaaggcaggggggcggatctgtcggacttcgagcccggggcgcgcgcc
cacgacatcgccgagcggatcagcgagatcgccggcgaacggaaggatccgcggttcgcc
caggcggtcctcgaggagagcgaggaactcgtcatggaggccccgtttatcctcgcggtg
actcactttggccacatcaccgtcaacgcgggcatcgaccgctcgaacgtccccggcgcg
gacctgctcctgttgcccgaggatccatcggcgagcgcgcagcgactgtccgacgcgctc
ggtgtccccgtcgtcgtgacagatacgtcgggacgcccctttcggcagggccagcgcggc
gtcgcacttggctgggccggaatttcggcaatgcgggactggcggggcgaacacgaccgc
gaaggacgcgaactcacggcgaccgtcgaggccgtcgtcgacgaactcgccgcggcgacc
aacctcgtcacgggcgagggcgacgacggccggccagtggcggtcgtccgcgactgggac
ttcggcgaccacgacagccacgacgatctgttccgggatcgtgatggcgatctcgtccgg
caggcactcgccgacttcgagtacgaccccgcgtga

DBGET integrated database retrieval system