KEGG   Halorhabdus utahensis: Huta_1472Help
Entry
Huta_1472         CDS       T00971                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hut  Halorhabdus utahensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hut00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449009..1450541
Genome map
AA seq 510 aa AA seqDB search
MTDTYVGAIDQGTTGTRFMVFDRDGQVAGNAYEKHEQFYPEPGWVEHDPLEIWANTKAVV
TAGLADAGLEAEQVAALGITNQRETTLVWDKDTGKPVHNALVWQDRRTTDRVEELQDEDK
VEWIRGKTGLEPDAYFSATKTEWILDNAEPLKLQSHRASDLHDRAESGELLMGTIDAWLI
YNLTGNHITDVTNASRTMLYNVHEMAWDGDLLAEFGVPEAMLPEVRPSSDENLYGHTDPD
GFLGAEIPVAGALGDQQAALFGQTCFEEGDAKNTYGTGSFYLMNTGTEAVESDHGLLTTI
AFQRSGEPVRYALEGSIFATGAAIEWLEDVDLINNAAQTADLASAVDSTDGVYLVPAFTG
LGAPHWDGRARGTIVGMTRGTRKEHIVRATLEAIAYQTRDVAEAMEADSGIETTTLRVDG
GAVKNDFLCQLQADVIRTDIARPEVDETTALGSAYAAGLAVGYWADLDELRENWRVDREF
TPEIPVEDADRMYSRWDDAVERARDWAREE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacctacgtcggcgcgatcgatcagggaacgaccgggacgcgctttatggtg
ttcgaccgcgacggccaggtcgcgggcaacgcctacgagaaacacgaacagttctatccg
gagccaggatgggtcgagcacgacccgctagagatctgggcgaacacaaaagcggtcgtc
actgcgggactggccgatgccggactcgaggccgagcaggtagctgcactgggaattacg
aaccagcgagagaccacgctcgtctgggacaaagacacgggcaagcccgtacacaacgcc
ctcgtctggcaggaccgccggaccaccgaccgggtcgaagagctccaggacgaagacaaa
gtcgagtggatccgtgggaagaccggcctcgaacccgacgcgtacttttcggcgacgaaa
acggagtggattctggacaacgccgaaccactgaaactccagagtcaccgggccagtgac
ctccacgaccgcgccgaaagcggcgagttgttgatggggacgatcgacgcgtggctgatc
tacaatctcacgggcaatcacatcacggacgtcaccaacgcctcccggacgatgctgtac
aacgtccacgagatggcgtgggacggggatctcctcgccgagttcggggtccccgaggcg
atgcttccggaagtgcggccctcctcggacgaaaacctctatggccacaccgatcccgac
gggttcctcggcgcggagatccccgtcgccggcgcactgggcgaccagcaggcagccctg
ttcggccagacctgtttcgaggagggagacgcgaagaacacctacggcaccggctccttt
tacctgatgaacacggggacggaagccgttgaatccgaccacggcctgctgacgacgatc
gcgttccagcggtcgggcgagcctgtcaggtacgccctggaggggtcgatcttcgccacc
ggggcggcgatcgaatggctcgaggacgtcgatctcatcaacaacgccgcccagaccgcg
gacctcgccagtgcggtcgactcgaccgacggcgtctatctcgtcccggccttcaccggc
ctcggcgcaccccactgggacgggcgcgctcgcgggacgatcgtcgggatgacccgcggc
acccggaaggaacacatcgtccgggcgacgctggaggccatcgcctaccagacgcgggac
gtcgccgaggcgatggaagccgactcggggatcgagacgaccacactccgggtcgacggc
ggggccgtcaagaacgacttcctgtgtcaactccaggccgacgtcatccggacggacatc
gctcgccccgaagtcgacgagacgacggccctcggttcggcgtatgcggctggcctcgcc
gtcggctactgggctgatctcgacgaactccgcgagaactggcgcgtcgaccgggagttc
accccggagatcccggtcgaggacgccgatcggatgtacagtcgctgggacgacgccgtc
gagcgcgccagagactgggctagggaggagtga

DBGET integrated database retrieval system