KEGG   Halorhabdus utahensis: Huta_1474Help
Entry
Huta_1474         CDS       T00971                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hut  Halorhabdus utahensis
Pathway
hut00010  Glycolysis / Gluconeogenesis
hut00052  Galactose metabolism
hut00500  Starch and sucrose metabolism
hut00520  Amino sugar and nucleotide sugar metabolism
hut00521  Streptomycin biosynthesis
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
hut01120  Microbial metabolism in diverse environments
hut01130  Biosynthesis of antibiotics
hut01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1474
   00052 Galactose metabolism
    Huta_1474
   00500 Starch and sucrose metabolism
    Huta_1474
   00520 Amino sugar and nucleotide sugar metabolism
    Huta_1474
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Huta_1474
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Huta_1474
Enzymes [BR:hut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Huta_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACV11650
UniProt: C7NP63
Position
complement(1451644..1452618)
Genome map
AA seq 324 aa AA seqDB search
MAVYAGVDLGATYVRAVVGDGTGKELGQDKRETPPGPTGIAVTETVLETLRAACTDAGVD
PTDVEAVGVASVGPLDLAEGVVENPANLPDTIETIPLTGPLGNLTGTDEVYLHNDAVAGV
IGERFHSDRNPDNMAYLTISTGIGAGVAVDGHVLSGWDGNVGEVGHMTLDSDGMMTCGCG
QDGHWEAYASGQNIPRYAREFYQAGDWETDMPVMDADFRAPDLFEYAGEDDFADAFIDRL
ATFNAMGVANIVQAYAPLVIHIGGAVAENNPELVVGKIRERLPEMVFGNIPEINITTLGD
DVVVKGALASALTEGTGDREKLRE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgtatacgctggtgtcgacctcggtgcgacgtacgtccgcgccgtcgtcggtgat
gggactggcaaggaactcgggcaggacaagcgggaaacgccaccgggcccgactggcatc
gccgtgaccgagacggtgcttgagacgctgcgtgcagcctgtacggatgcgggggtcgac
cccaccgacgtcgaagcggtcggggtcgcgtccgtcggcccgctggatctcgccgaaggt
gttgtcgaaaacccggcgaacctcccggacacgatcgagacgatcccgctgactgggccg
ctcgggaacctcaccgggaccgacgaggtctacctccacaacgatgcggtcgccggtgtg
atcggcgagcgctttcacagcgaccgcaaccccgacaacatggcctatctgaccatctcg
acggggatcggcgcgggcgtcgcggtcgacggccacgttctgagtggctgggacggcaac
gtcggtgaagtcggccacatgacgctcgattcggacgggatgatgacgtgtgggtgtggc
caggacggccactgggaggcctacgcttccggacagaacatcccccggtacgcccgcgag
ttctaccaggccggcgactgggagacggatatgcccgtcatggacgccgacttcagggcc
ccggacctcttcgaatatgccggtgaggacgactttgccgacgcgttcatcgaccgcctc
gccacgttcaacgcgatgggcgtcgccaacatcgtccaggcgtacgcgccgctggtgatc
cacatcggcggagccgttgccgagaacaatccggaactcgtcgtcgggaagatccgcgag
cgcctcccggagatggtctttggcaacatcccggagatcaacatcacgacccttggcgac
gacgtggtggtcaaaggtgccctggcgagtgccctgaccgaagggaccggcgaccgcgag
aaacttcgcgagtga

DBGET integrated database retrieval system