KEGG   Halorhabdus utahensis: Huta_1474Help
Entry
Huta_1474         CDS       T00971                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_1474
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1474
   00052 Galactose metabolism
    Huta_1474
   00500 Starch and sucrose metabolism
    Huta_1474
   00520 Amino sugar and nucleotide sugar metabolism
    Huta_1474
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Huta_1474
   00524 Butirosin and neomycin biosynthesis
    Huta_1474
Enzymes [BR:hut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Huta_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1451644..1452618)
Genome map
AA seq 324 aa AA seqDB search
MAVYAGVDLGATYVRAVVGDGTGKELGQDKRETPPGPTGIAVTETVLETLRAACTDAGVD
PTDVEAVGVASVGPLDLAEGVVENPANLPDTIETIPLTGPLGNLTGTDEVYLHNDAVAGV
IGERFHSDRNPDNMAYLTISTGIGAGVAVDGHVLSGWDGNVGEVGHMTLDSDGMMTCGCG
QDGHWEAYASGQNIPRYAREFYQAGDWETDMPVMDADFRAPDLFEYAGEDDFADAFIDRL
ATFNAMGVANIVQAYAPLVIHIGGAVAENNPELVVGKIRERLPEMVFGNIPEINITTLGD
DVVVKGALASALTEGTGDREKLRE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgtatacgctggtgtcgacctcggtgcgacgtacgtccgcgccgtcgtcggtgat
gggactggcaaggaactcgggcaggacaagcgggaaacgccaccgggcccgactggcatc
gccgtgaccgagacggtgcttgagacgctgcgtgcagcctgtacggatgcgggggtcgac
cccaccgacgtcgaagcggtcggggtcgcgtccgtcggcccgctggatctcgccgaaggt
gttgtcgaaaacccggcgaacctcccggacacgatcgagacgatcccgctgactgggccg
ctcgggaacctcaccgggaccgacgaggtctacctccacaacgatgcggtcgccggtgtg
atcggcgagcgctttcacagcgaccgcaaccccgacaacatggcctatctgaccatctcg
acggggatcggcgcgggcgtcgcggtcgacggccacgttctgagtggctgggacggcaac
gtcggtgaagtcggccacatgacgctcgattcggacgggatgatgacgtgtgggtgtggc
caggacggccactgggaggcctacgcttccggacagaacatcccccggtacgcccgcgag
ttctaccaggccggcgactgggagacggatatgcccgtcatggacgccgacttcagggcc
ccggacctcttcgaatatgccggtgaggacgactttgccgacgcgttcatcgaccgcctc
gccacgttcaacgcgatgggcgtcgccaacatcgtccaggcgtacgcgccgctggtgatc
cacatcggcggagccgttgccgagaacaatccggaactcgtcgtcgggaagatccgcgag
cgcctcccggagatggtctttggcaacatcccggagatcaacatcacgacccttggcgac
gacgtggtggtcaaaggtgccctggcgagtgccctgaccgaagggaccggcgaccgcgag
aaacttcgcgagtga

DBGET integrated database retrieval system