KEGG   Halorhabdus utahensis: Huta_1479Help
Entry
Huta_1479         CDS       T00971                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hut  Halorhabdus utahensis
Pathway
hut00010  Glycolysis / Gluconeogenesis
hut00020  Citrate cycle (TCA cycle)
hut00620  Pyruvate metabolism
hut00640  Propanoate metabolism
hut00650  Butanoate metabolism
hut00680  Methane metabolism
hut00720  Carbon fixation pathways in prokaryotes
hut01100  Metabolic pathways
hut01120  Microbial metabolism in diverse environments
hut01130  Biosynthesis of antibiotics
hut01200  Carbon metabolism
Module
hut_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1479
   00020 Citrate cycle (TCA cycle)
    Huta_1479
   00620 Pyruvate metabolism
    Huta_1479
   00640 Propanoate metabolism
    Huta_1479
   00650 Butanoate metabolism
    Huta_1479
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_1479
   00680 Methane metabolism
    Huta_1479
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Huta_1479
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Huta_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ACV11655
UniProt: C7NP68
Position
1457972..1458511
Genome map
AA seq 179 aa AA seqDB search
MEEIRIHGRGGQGSVTLAQLLAQAAHEEGTWAQAFPAFGVERRGAPVEAFARFDETKITD
RSQVDEPDYVIVQDTSLLEYVDVTDGLNEDGLVLVNTDADPEELDIETDAEVVTVDATEI
ALQHLGRPIMNTALLGAFAGATGLLGQDSMEAVITRKFGGEIGEQNVAATNEAFSEVSA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatacgcattcacggtcgtggcggccagggttcggttacactggcacagtta
ttggcacaagcagcacacgaagaaggaacctgggcacaggcgttcccggcgttcggcgtc
gagcgacgtggcgcgcccgtcgaggcgttcgcgcgcttcgacgagacgaagatcacggat
cgcagccaggttgacgagcccgactacgtcatcgttcaggacacgagcctgctcgagtac
gtcgacgtcaccgatggactcaacgaggacggcctcgtgttggtcaacactgacgccgac
cccgaagagttggatatcgagaccgacgccgaggtcgtcacggtcgacgcgaccgagatc
gccctccagcacctcggtcgcccgatcatgaacaccgcgctgctcggggccttcgccggc
gcgaccggcctgctcggtcaggacagcatggaagccgtcatcacccggaagttcggcggc
gagatcggcgagcagaacgtcgccgcaaccaacgaagccttctcggaggtatcagcatga

DBGET integrated database retrieval system