KEGG   Halorhabdus utahensis: Huta_1479Help
Entry
Huta_1479         CDS       T00971                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_1479
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1479
   00020 Citrate cycle (TCA cycle)
    Huta_1479
   00620 Pyruvate metabolism
    Huta_1479
   00640 Propanoate metabolism
    Huta_1479
   00650 Butanoate metabolism
    Huta_1479
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_1479
   00680 Methane metabolism
    Huta_1479
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Huta_1479
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Huta_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1457972..1458511
Genome map
AA seq 179 aa AA seqDB search
MEEIRIHGRGGQGSVTLAQLLAQAAHEEGTWAQAFPAFGVERRGAPVEAFARFDETKITD
RSQVDEPDYVIVQDTSLLEYVDVTDGLNEDGLVLVNTDADPEELDIETDAEVVTVDATEI
ALQHLGRPIMNTALLGAFAGATGLLGQDSMEAVITRKFGGEIGEQNVAATNEAFSEVSA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatacgcattcacggtcgtggcggccagggttcggttacactggcacagtta
ttggcacaagcagcacacgaagaaggaacctgggcacaggcgttcccggcgttcggcgtc
gagcgacgtggcgcgcccgtcgaggcgttcgcgcgcttcgacgagacgaagatcacggat
cgcagccaggttgacgagcccgactacgtcatcgttcaggacacgagcctgctcgagtac
gtcgacgtcaccgatggactcaacgaggacggcctcgtgttggtcaacactgacgccgac
cccgaagagttggatatcgagaccgacgccgaggtcgtcacggtcgacgcgaccgagatc
gccctccagcacctcggtcgcccgatcatgaacaccgcgctgctcggggccttcgccggc
gcgaccggcctgctcggtcaggacagcatggaagccgtcatcacccggaagttcggcggc
gagatcggcgagcagaacgtcgccgcaaccaacgaagccttctcggaggtatcagcatga

DBGET integrated database retrieval system