KEGG   Halorhabdus utahensis: Huta_1481Help
Entry
Huta_1481         CDS       T00971                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_1481
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1481
   00020 Citrate cycle (TCA cycle)
    Huta_1481
   00620 Pyruvate metabolism
    Huta_1481
   00640 Propanoate metabolism
    Huta_1481
   00650 Butanoate metabolism
    Huta_1481
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_1481
   00680 Methane metabolism
    Huta_1481
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Huta_1481
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Huta_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1458803..1460038
Genome map
AA seq 411 aa AA seqDB search
MAKAEQEPNPSGEQEVMKGTSAVAKGVMAADPDVISAYPITPQTGVVEKLSELVADGELD
SEFIKVDSEFNAASTCIGASAAGARAFSATSSQGLKLMSEPLFTAAGMRLPIVMAVANRS
LSAPLSIWADHTDAFAERDGGMLQFHAEDVQEAIDHVLMGFRVAEQVNLPVLSNFDGFIL
THVQEPADIPSEEEVNEFLPPRDPAFTLDPSDPKTMGAYARPEHWTEARYEIQAAMMESK
EVWAETVEEFKEVFGRDYTEYNGMIDTYHGDADYRLVALGSMCGTIRGVIDQYREQGVDV
GLVRPRVHRPFPTEEIRKALGDAEAVGVLTKEMSPGYESALAGEIKGTLYHAENQPPIKS
FVIGMAGRDITAAEIGAMIEETMEASGPMTFDEQESWPQLREELLQTGGDQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctgagcaagagccaaatccgtccggcgagcaggaagtgatgaaagggacg
tcggccgtcgccaagggcgtcatggccgccgaccccgacgtcatctcggcgtacccgatc
accccccagaccggcgtcgtcgagaagctctcggaactcgtcgccgacggcgaactcgac
agcgagttcatcaaggtcgacagcgagttcaacgccgcttcgacgtgtatcggcgcgtcg
gcggccggcgctcgcgcgttctccgcgacgtcgagccagggcctgaagctgatgagcgaa
ccgctgttcacggcggcgggcatgcgccttccgatcgtgatggcggtcgccaaccggtcg
ctgtcggcccccctctcgatctgggccgaccacaccgacgccttcgccgagcgcgacggc
ggcatgttgcagttccacgccgaggacgtccaggaagccatcgaccacgtcctgatgggc
ttccgtgtcgccgaacaggtcaatctccctgtcctctcgaactttgacggctttattctg
acccacgtccaggaacccgccgacatcccgagcgaggaggaggtcaacgagttcctgccg
ccgcgtgaccccgcgttcacgctcgatcccagcgatccgaagacgatgggtgcctacgcc
cggcccgaacactggacggaggcgcgctacgagatccaggccgcgatgatggagtccaaa
gaggtctgggccgaaaccgtcgaggagttcaaggaggtcttcggccgggactacaccgag
tacaacggcatgatcgacacctaccacggcgacgccgactaccgcctcgtcgccctgggg
tcgatgtgcgggacgatccgcggcgtcatcgaccagtaccgcgagcagggcgtcgacgtc
gggctcgtccgcccgcgcgtccaccggccgttcccgaccgaggagatccggaaagcgctc
ggcgacgccgaggccgtcggcgtcctgaccaaggagatgtcgcccggctacgagtccgca
ctcgccggcgagatcaaggggacgctgtaccacgccgagaaccagccgccgatcaagagc
ttcgtcatcgggatggccggccgggacatcaccgccgccgagatcggcgcgatgatcgag
gagaccatggaggcctccgggccgatgactttcgacgagcaggaatcgtggccacagctg
cgtgaggaactcctccaaactggaggcgatcaataa

DBGET integrated database retrieval system