KEGG   Halorhabdus utahensis: Huta_1481Help
Entry
Huta_1481         CDS       T00971                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hut01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hut00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hut00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hut00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hut00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hut00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hut00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1458803..1460038
Genome map
AA seq 411 aa AA seqDB search
MAKAEQEPNPSGEQEVMKGTSAVAKGVMAADPDVISAYPITPQTGVVEKLSELVADGELD
SEFIKVDSEFNAASTCIGASAAGARAFSATSSQGLKLMSEPLFTAAGMRLPIVMAVANRS
LSAPLSIWADHTDAFAERDGGMLQFHAEDVQEAIDHVLMGFRVAEQVNLPVLSNFDGFIL
THVQEPADIPSEEEVNEFLPPRDPAFTLDPSDPKTMGAYARPEHWTEARYEIQAAMMESK
EVWAETVEEFKEVFGRDYTEYNGMIDTYHGDADYRLVALGSMCGTIRGVIDQYREQGVDV
GLVRPRVHRPFPTEEIRKALGDAEAVGVLTKEMSPGYESALAGEIKGTLYHAENQPPIKS
FVIGMAGRDITAAEIGAMIEETMEASGPMTFDEQESWPQLREELLQTGGDQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctgagcaagagccaaatccgtccggcgagcaggaagtgatgaaagggacg
tcggccgtcgccaagggcgtcatggccgccgaccccgacgtcatctcggcgtacccgatc
accccccagaccggcgtcgtcgagaagctctcggaactcgtcgccgacggcgaactcgac
agcgagttcatcaaggtcgacagcgagttcaacgccgcttcgacgtgtatcggcgcgtcg
gcggccggcgctcgcgcgttctccgcgacgtcgagccagggcctgaagctgatgagcgaa
ccgctgttcacggcggcgggcatgcgccttccgatcgtgatggcggtcgccaaccggtcg
ctgtcggcccccctctcgatctgggccgaccacaccgacgccttcgccgagcgcgacggc
ggcatgttgcagttccacgccgaggacgtccaggaagccatcgaccacgtcctgatgggc
ttccgtgtcgccgaacaggtcaatctccctgtcctctcgaactttgacggctttattctg
acccacgtccaggaacccgccgacatcccgagcgaggaggaggtcaacgagttcctgccg
ccgcgtgaccccgcgttcacgctcgatcccagcgatccgaagacgatgggtgcctacgcc
cggcccgaacactggacggaggcgcgctacgagatccaggccgcgatgatggagtccaaa
gaggtctgggccgaaaccgtcgaggagttcaaggaggtcttcggccgggactacaccgag
tacaacggcatgatcgacacctaccacggcgacgccgactaccgcctcgtcgccctgggg
tcgatgtgcgggacgatccgcggcgtcatcgaccagtaccgcgagcagggcgtcgacgtc
gggctcgtccgcccgcgcgtccaccggccgttcccgaccgaggagatccggaaagcgctc
ggcgacgccgaggccgtcggcgtcctgaccaaggagatgtcgcccggctacgagtccgca
ctcgccggcgagatcaaggggacgctgtaccacgccgagaaccagccgccgatcaagagc
ttcgtcatcgggatggccggccgggacatcaccgccgccgagatcggcgcgatgatcgag
gagaccatggaggcctccgggccgatgactttcgacgagcaggaatcgtggccacagctg
cgtgaggaactcctccaaactggaggcgatcaataa

DBGET integrated database retrieval system