KEGG   Halorhabdus utahensis: Huta_1482Help
Entry
Huta_1482         CDS       T00971                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_1482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_1482
   00020 Citrate cycle (TCA cycle)
    Huta_1482
   00620 Pyruvate metabolism
    Huta_1482
   00640 Propanoate metabolism
    Huta_1482
   00650 Butanoate metabolism
    Huta_1482
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_1482
   00680 Methane metabolism
    Huta_1482
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Huta_1482
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Huta_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460038..1460994
Genome map
AA seq 318 aa AA seqDB search
MSSDLQDQDYTDEVEHGEELWNPGHRACAGCGPALAMKYITEAAGENTIISQPTGCMEVV
STPYPESSWGTSYIHNIFENAASVASGIEAAYKSFDRRDPDHLDVEKEDDVNIIAVGGDG
ATADIGIRALSGMMERGHDVTYIMYDNEAYMNTGVQRSSQTPLGASTTTSPAGEVSIGND
TNKKDMASIAADHGVGYVATASISNPNDFKQKVEEALSRDGPKFLHVYSPCPVGWSYESS
KTVELAELAVETGLFPVFEMEDGEITSVNKIRDRKPVREWLETQGRFKHLFKDEKGEQAI
EELQEWIDDRAEDLGLDA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagacttacaggaccaggactacaccgacgaggtcgaacacggcgaggaactc
tggaaccccggccaccgcgcgtgtgccgggtgtggccccgcactggcgatgaaatacatc
accgaggccgccggcgagaacaccatcatcagccagcccactggctgtatggaggtcgtc
tcgacgccctaccccgagagttcctggggtaccagttacatccacaatatcttcgagaac
gcggcgagcgtcgcctcgggcatcgaggccgcctacaagtccttcgaccgccgtgacccc
gatcacctggatgtcgagaaggaagacgacgtcaacatcatcgcggtcggtggcgacggc
gcgaccgctgacatcggcatccgcgcactcagtggtatgatggagcgcggtcacgacgtc
acctacatcatgtacgacaacgaggcgtacatgaacacgggcgtccagcgctccagtcag
accccgctcggggcctcgacgacgacgtcgccggccggcgaggtcagcatcggcaacgac
accaacaagaaggacatggcctcgatcgcggccgaccacggcgtcggctacgtcgcgacg
gcctcgatctcgaaccccaacgacttcaagcagaaagtcgaggaggccctctcgcgtgac
ggaccgaagttcctgcacgtctactcgccgtgtccggtcggctggagctacgagtcctcg
aagacggtggaactcgccgaactcgccgtcgagaccgggctgttcccggtcttcgagatg
gaggacggcgagatcacgagcgtgaacaagatccgcgaccgcaagccggttcgcgaatgg
ctcgaaacccagggccggttcaagcacctcttcaaggacgagaagggcgagcaagccatc
gaggagcttcaagagtggatcgacgaccgcgccgaggatctcggtctcgacgcctaa

DBGET integrated database retrieval system