KEGG   Halorhabdus utahensis: Huta_1962Help
Entry
Huta_1962         CDS       T00971                                 

Definition
Endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
hut  Halorhabdus utahensis
Brite
Enzymes [BR:hut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Huta_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1986598..1987833
Genome map
AA seq 411 aa AA seqDB search
MGRHNIEDAADESSDNGRIGRFDRRSYLKGAAATVATGLGIGSIASPAAAITSNQTGNDS
GYYYSFWTNAEGTVEMTLGDGGNYSVDWSDTGNFVCGKGWQTGGRRDVDYTANYNPSGNS
YLCLYGWTTDPLVEYYIIEDYGSYKPGDSYQGTHTTNGSTYEIYTSERVNKPSIEGNATF
TQYWSVRQNSRTSGTITTGNHFDAWENHGLPMGNHDYMILATEGYQSSGSSEVWVGADGS
GGSGGGGGGGGGGGGSGGGGGGSSGSSNPPASGTYSIQNVNSGKGMDVAGQSTSDGANVQ
QYSYWGGENQQWNVEDTGGGQFRIQNVNSGKVLDVANQSTEDGANVHQYSDGGGDNQRFY
LNDQGGGQYHIQPVHSQKAVEITSSSTSDGANVQQYDWHGGNNQLWTFESV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggggcgacataacatcgaagacgcggcggacgaatcgagcgacaacggccgaatcggc
cggttcgatcggcggagctatctgaaaggagcggccgcgacagtggcgacaggactcggc
attggatccatcgcgagtccggccgcggccatcacctcgaaccagactggcaacgacagc
gggtattactactccttctggaccaacgccgagggcacagtcgagatgacgctgggagac
ggcggcaattacagtgtcgactggtcggacacaggcaacttcgtctgtggcaaaggttgg
cagacgggtggccgccgtgacgtcgattacacggccaactacaacccgtcgggtaactct
tacctgtgtctatacgggtggacgacggacccgctggtggagtactacatcatcgaggat
tacggcagctacaagccgggcgactcctatcaggggacccatactaccaacgggtcgacc
tacgagatctacacgtccgagcgggtgaacaagccctcgatcgagggcaatgcaacgttc
acgcagtactggtccgttcggcagaactcccggacgagcgggacgatcacgaccggcaat
catttcgatgcctgggagaaccacgggctgcccatgggcaaccacgactacatgatcctg
gccaccgagggttaccagagcagcggctcctcggaggtctgggtcggtgccgacggtagc
ggcggtagcggcggtggcggtggtggcggtggcggaggcggcggttccggcggaggcggc
ggtggttcgagtggctcctcgaatccgccggctagcggcacctacagcatccagaacgtc
aacagcgggaagggcatggacgtcgccgggcagtcgacgtcggacggtgcgaacgtccag
cagtacagctactggggcggcgagaaccagcagtggaacgtcgaggatacgggcggcggg
cagttccggatccagaacgtcaacagcgggaaagtgctcgacgtcgccaaccagtccacc
gaggacggtgcgaacgtccatcagtactcggacggcggcggcgacaaccagcgcttctac
ctgaacgaccagggcggcggccagtatcatatccagccagtccacagccagaaggctgtc
gagattacgagttcctcgacatcggatggtgcgaacgtccagcagtacgactggcacggc
ggtaacaaccaactctggacgttcgagtcggtctag

DBGET integrated database retrieval system