KEGG   Halorhabdus utahensis: Huta_2233Help
Entry
Huta_2233         CDS       T00971                                 

Definition
extracellular solute-binding protein family 5
Orthology
K02035  
peptide/nickel transport system substrate-binding protein
Organism
hut  Halorhabdus utahensis
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2279629..2281836)
Genome map
AA seq 735 aa AA seqDB search
MSDEFSLSPTRRQLLASLGTGGVLAGGVAGFRTMADVVTPIAAQSPQRGTLVGTMTGPTQ
GLHFNLFGTSSADIPAAMVFDPTVKYHRGRGEFIPAAVTEWTVEGETMTLSLRPDLVWDD
GDPVTARDLRTQLLLGKTVDDDLWEYATAVETLGEKRLAVHFDASYNPDLLERIVLGDRR
LFVKHEYYEPFLETLRADGEIAAREELMAFTPTSMGEFAASGPFTVDSIDTEGIKLELNP
THPDSDSIGFQSYEFRALLGTDTGFQALETGQVDVIASMSTLPNQPIELPSSVVQVRIPD
YWGLGLWPNHDVEPLDDRAVRQAIAFVIDRSAVTQASGRETNQPVETPSGLPASAVADWI
AQDSLETYVDPDNEAATDVLSRAGYTREDGTWTAEDGTPLGFSISVPEFITDFVNATDSV
AEQLRSFGIEADVREVTFRDIFAGDFDVVSGWWLPGSIDSTHPYVAYRFGFGMGMVQPDL
LEYPGLDSTVTVPADGNNGSIDVTPQDELEALATTVDRGEAESIVQRLAKVYNADLPMLP
LYRSQYTSFIDTSAVDAPAEGSPKFQITWPPHWLVRTGDLHSPGWAENEASTPTETVTNT
PTATDTERETPSATETETTQPTETATESSPSTPSETATKTVTPTATPTDPKTATVSETVT
NTPATTETDRSATESRTTTVTEIPTSTTDAESEGGQNTQDSTDGATTTNGPGFGLLSSVA
GLGSYALYRARKRDG
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgagttttcactcagtccaacccgtcggcagttgctcgcatcgcttgggact
ggcggcgtgcttgctggtggggttgcgggtttcaggacgatggcggatgtcgtcacccca
atagcagcccaatcgccccagcgcgggacactcgtggggacgatgaccggccctacccag
ggactgcacttcaacctctttggaacgtcgagcgcggatatccccgctgcgatggtgttt
gacccgacggtgaaataccatcgtggtcgcggcgaattcatcccggccgccgtgacggag
tggacagtcgagggcgaaaccatgaccctctcgctgcgaccggatcttgtctgggacgac
ggcgatccggtgacggcccgcgatctgcgaacccagctactgctcggcaagaccgtcgac
gacgatctttgggaatacgccacggcagtcgagacgctcggggaaaagcgactcgcggtt
cacttcgacgcgtcgtacaatccggacttgctcgaacgcatcgttctcggagaccgccga
ctgttcgtcaaacatgagtattacgagccgtttctggagacgttacgtgccgacggcgaa
atcgccgccagagaggaactcatggcattcacgcctacgtcgatgggcgaattcgccgca
agcggccccttcactgtcgactcgatcgacaccgagggaatcaaactcgaactgaatccg
acccatcccgacagcgattccatcgggttccagtcctacgagtttcgcgccttgctcgga
acagacacggggtttcaggcactcgaaaccggccaggtcgacgtgatcgcctcgatgtcg
acgctaccgaaccagcccatcgaattgccatcatccgttgtacaggtgcggatccccgat
tattgggggttgggcctctggccgaaccacgatgtcgagccgctggacgaccgggccgtc
cgacaggcaatcgcctttgtcatcgaccgctcggccgtgacccaggcgagtggccgggaa
acgaaccagccggtagagacgccaagtggcctgccggcgtccgctgttgcggactggata
gcgcaggattcactggagacgtatgtcgatccggataacgaggctgcgacagacgtcctg
tcgagggcaggatatactcgcgaggatggaacctggacggcggaggacgggacccccctc
ggcttttcgatatcggtccccgagttcatcaccgacttcgtcaacgcgacggattccgtc
gccgaacaactccgttcgttcggcatcgaagccgacgttcgggaagtgacgtttcgggac
atcttcgccggtgacttcgacgtcgtgtcggggtggtggctaccggggagcatcgacagt
acacacccgtacgtcgcgtacaggttcgggttcggcatggggatggtccagcccgatcta
ctcgagtatccagggttggacagcaccgtgactgtgcccgcggacgggaacaacggctcg
atagacgtcactccccaagacgaactggaagcgctggccacgactgtcgaccgcggcgag
gccgaatcgatcgtgcagcgactcgcaaaggtgtacaacgcggaccttccgatgctccca
ctctaccggagtcaatatacgtcgttcatcgatacgagcgccgtcgacgcaccggcggaa
ggttcaccgaagttccagatcacgtggcccccgcactggcttgttcgaaccggcgatctg
cacagtccaggctgggccgagaacgaagcctcgacacccaccgagacagtgacaaatacg
ccgactgcgacggacacggaacgggagacgccatcggcaaccgaaaccgagacgacacaa
ccgacggagacggcgacagaatccagcccgtcgacaccgagcgagacggcgacgaaaacg
gtgacgccgacagcaaccccgacagacccaaaaacagcgacagtcagcgagacagtcacg
aacactccggcaacgaccgagacagaccgatcggccactgaatcacggacgacgacggtc
acggagataccgacctcgacgaccgatgctgaatcagaaggtggccagaacacccaggac
agcaccgacggagccaccacgaccaacggtccggggttcggtctcctctcgtcggtggct
ggattaggtagctacgcgctctatcgggccaggaaacgggacgggtag

DBGET integrated database retrieval system